PDB entry 5k41

View 5k41 on RCSB PDB site
Description: Structure of Mycobacterium thermoresistibile trehalose-6-phosphate synthase in a complex with ADP-glucose.
Class: transferase
Keywords: OtsA trehalose-6-phosphate synthase, Trehalose, transferase
Deposited on 2016-05-20, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha,alpha-trehalose-phosphate synthase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Gene: RMCT_1906
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k41a_
  • Heterogens: ADQ, NHE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k41A (A:)
    smadrgdsgdsdfvvvanrlpidlerapdgttswkrspgglvtalepllrrrrgawigwp
    gipdsdedpivdgdlvlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwwery
    vevnrrfaeatsraaargatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmq
    lpwrteitdgllgadlvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrt
    vkvgafpisidsadldrqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqa
    faellaegrvnredtvfvqlatpsrerveayrllrddierqvghingeygevghpvvhyl
    hrpvpreeliaffvaadvmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgq
    aylvnphnldhvkdtmvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastrtg
    dadavpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k41A (A:)
    sgdsdfvvvanrlpidlswkrspgglvtalepllrrrrgawigwpgipdsdedpivdgdl
    vlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwweryvevnrrfaeatsraa
    argatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmqlpwrteitdgllgad
    lvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrtvkvgafpisidsadl
    drqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqafaellaegrvnredt
    vfvqlatpsrerveayrllrddierqvghingeygevghpvvhylhrpvpreeliaffva
    advmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgqaylvnphnldhvkdt
    mvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastr