PDB entry 5k3h

View 5k3h on RCSB PDB site
Description: Crystals structure of Acyl-CoA oxidase-1 in Caenorhabditis elegans, Apo form-II
Class: oxidoreductase
Keywords: dauer pheromone, ascarosides, b-oxidation, ATP, OXIDOREDUCTASE
Deposited on 2016-05-19, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3ha1, d5k3ha2, d5k3ha3
  • Chain 'B':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3hb1, d5k3hb2, d5k3hb3
  • Chain 'C':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3hc1, d5k3hc2, d5k3hc3
  • Chain 'D':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3hd1, d5k3hd2, d5k3hd3
  • Chain 'E':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3he1, d5k3he2, d5k3he3
  • Chain 'F':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3hf1, d5k3hf2, d5k3hf3
  • Chain 'G':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3hg1, d5k3hg2, d5k3hg3
  • Chain 'H':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k3hh1, d5k3hh2, d5k3hh3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k3hA (A:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hA (A:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpymltgqaimlsyalniatry
    savrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervldlhalts
    glksvvthqtgegiearmacgghgysmasyiseiygvaiggnmvmllqlarylvksaalv
    ksgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglme
    ngekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyel
    ldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdgh
    vyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k3hB (B:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hB (B:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhaltsg
    lksvvthqtgegieqarmacgghgysmasyiseiygvaiggenmvmllqlarylvksaal
    vksgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglm
    engekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnye
    lldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdg
    hvyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k3hC (C:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hC (C:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhaltsg
    lksvvthqtgegieqarmacgghgysmasyiseiygvaignmvmllqlarylvksaalvk
    sgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglmen
    gekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyell
    dvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdghv
    yenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k3hD (D:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hD (D:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhaltsg
    lksvvthqtgegieqarmacgghgysmasyiseiygvaigenmvmllqlarylvksaalv
    ksgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglme
    ngekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyel
    ldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdgh
    vyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5k3hE (E:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hE (E:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhaltsg
    lksvvthqtgegieqarmacgghgysmasyiseiygvaiggenmvmllqlarylvksaal
    vksgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglm
    engekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnye
    lldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdg
    hvyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5k3hF (F:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hF (F:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervldlhaltsgl
    ksvvthqtgegieqarmacgghgysmasyiseiygvaigenmvmllqlarylvksaalvk
    sgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglmen
    gekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyell
    dvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdghv
    yenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5k3hG (G:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hG (G:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhaltsg
    lksvvthqtgegieqarmacgghgysmasyiseiygvaigenmvmllqlarylvksaalv
    ksgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglme
    ngekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyel
    ldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdgh
    vyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5k3hH (H:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3hH (H:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhaltsg
    lksvvthqtgegieqarmacgghgysmasyiseiygvaigenmvmllqlarylvksaalv
    ksgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglme
    ngekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyel
    ldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdgh
    vyenlfkwakesplnktdvlpsvdtylkpmmeka