PDB entry 5k3g

View 5k3g on RCSB PDB site
Description: Crystals structure of Acyl-CoA oxidase-1 in Caenorhabditis elegans, Apo form-I
Class: oxidoreductase
Keywords: dauer pheromone, ascarosides, b-oxidation, ATP, OXIDOREDUCTASE
Deposited on 2016-05-19, released 2016-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k3ga1, d5k3ga2, d5k3ga3
  • Chain 'B':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k3gb1, d5k3gb2, d5k3gb3
  • Chain 'C':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k3gc1, d5k3gc2, d5k3gc3
  • Chain 'D':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k3gd1, d5k3gd2, d5k3gd3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k3gA (A:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3gA (A:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyiymltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyerdlhaltsglks
    vvthqtgegieqarmacgghgysmasyiseiygvaiggvmllqlarylvksaalvksgka
    sqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglmengekr
    eiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyelldvat
    yaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdghvyenl
    fkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k3gB (B:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3gB (B:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikymltgqaimlsyalniatrys
    avrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervladlhalts
    glksvvthqtgegieqarmacgghgysmasyiseiygvaigmvmllqlarylvksaalvk
    sgkasqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglmen
    gekreiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyell
    dvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdghv
    yenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k3gC (C:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3gC (C:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpltgqaimlsyalniatrysa
    vrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervllhaltsglk
    svvthqtgegieqarmacgghgysmasyiseiygvaigmvmllqlarylvksaalvksgk
    asqlgplvaylgarseptslidrvpnggiteyiktfqhiakrqtlkaankffglmengek
    reiawnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyelldva
    tyaledgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdghvyen
    lfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k3gD (D:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyegenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3gD (D:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikltgqaimlsyalniatrysav
    rrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervlhaltsglksv
    vthqtgegieqarmacgghgysmasyiseiygvaigmvmllqlarylvksaalvksgkas
    qlgplvaylgarseptslidrvpgiteyiktfqhiakrqtlkaankffglmengekreia
    wnkssvelnrasrlhtrlfiveafarrvneigditikealsdllhlhvnyelldvatyal
    edgfmsstqldyvrdqlyfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkw
    akesplnktdvlpsvdtylkpmmeka