PDB entry 5k39

View 5k39 on RCSB PDB site
Description: the type II cohesin dockerin complex from clostridium thermocellum
Class: structural protein
Keywords: S-LAYER, SECRETED, CELL WALL, MEMBRANE PROTEIN, structural protein
Deposited on 2016-05-19, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosome anchoring protein cohesin region
    Species: Ruminiclostridium thermocellum 27405 [TaxId:1249482]
    Gene: AD2_00639
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U3TQ90 (3-162)
      • expression tag (2)
      • expression tag (163-168)
    Domains in SCOPe 2.07: d5k39a1, d5k39a2, d5k39a3
  • Chain 'B':
    Compound: Dockerin module from a protein of unknown function
    Species: Clostridium thermocellum 27405 [TaxId:1249482]
    Gene: Cthe_1806
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k39b1, d5k39b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k39A (A:)
    masahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftk
    etllvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfk
    vlkaanttvkleetrftpnsidgtlvidwygqqivgykviqpdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k39A (A:)
    sahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftket
    llvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvl
    kaanttvkleetrftpnsidgtlvidwygqqivgykviqpdlehhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k39B (B:)
    mnndstdkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgd
    mreftleiskrnylkrnvtvngtgklvvstednplilwagdverkgvqdnainmvdvmei
    skvfgtragdeeyvaeldlnmdgainlfdiaivirhfnalpsry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k39B (B:)
    dkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftl
    eiskrnylkrnvtvngtgklvvstednplilwagdverkgvqdnainmvdvmeiskvfgt
    ragdeeyvaeldlnmdgainlfdiaivirhfna