PDB entry 5k32

View 5k32 on RCSB PDB site
Description: PDE4D crystal structure in complex with small molecule inhibitor
Class: hydrolase
Keywords: phosphodiesterases, inhibitor, hydrolase
Deposited on 2016-05-19, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k32a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08499 (1-324)
      • expression tag (0)
    Domains in SCOPe 2.07: d5k32b1, d5k32b2
  • Heterogens: ZN, MG, 6Q2, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k32A (A:)
    aqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
    mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
    vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
    ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
    qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
    lvhpdaqdildtlednrewyqstip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k32A (A:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
    lyrqwtdrimeeffrqgdrerergmeiscdkhnasveksqvgfidyivhplwetwadlvh
    pdaqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k32B (B:)
    aqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
    mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
    vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
    ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
    qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
    lvhpdaqdildtlednrewyqstip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k32B (B:)
    aqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
    mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
    vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
    ivlatdmskhmnlladlktmvetkkvtsvllldnysdriqvlqnmvhcadlsnptkplql
    yrqwtdrimeeffrqgdrerergmeiscdkhnasveksqvgfidyivhplwetwadlvhp
    daqdildtlednrewyqstip