PDB entry 5k2x

View 5k2x on RCSB PDB site
Description: crystal structure of m. tuberculosis uspc (tetragonal crystal form)
Deposited on 2016-05-19, released 2016-06-01
The last revision was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sugar ABC transporter permease
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: uspC, ERS007688_00434
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0T5Y5I3 (0-406)
      • expression tag (407-413)
  • Heterogens: IOD, EDO, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k2xA (A:)
    prggkivvtvrlwdepiaaayrqsfaaftrshpdievrtnlvaystyfetlrtdvaggsa
    ddifwlsnayfaayadsgrlmkiqtdaadwepavvdqftrsgvlwgvpqltdagiavfyn
    adllaaagvdptqvdnlrwsrgdddtlrpmlarltvdadgrtantpgfdarrvrqwgyna
    andpqaiylnyigsaggvfqrdgkfafdnpgaieafrylvglinddhvappasdtndngd
    fsrnqflagkmalfqsgtyslapvardalfhwgvamlpagpagrvsvtngiaaagnsask
    hpdavrqvlawmgstegnsylgrhgaaipavlsaqpvyfdywsargvdvtpffavlngpr
    iaapggagfaagqqalepyfdemflgrgdvtttlrqaqaaanaatqrklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5k2xA (A:)
    prggkivvtvrlwdepiaaayrqsfaaftrshpdievrtnlvaystyfetlrtdvaggsa
    ddifwlsnayfaayadsgrlmkiqtdaadwepavvdqftrsgvlwgvpqltdagiavfyn
    adllaaagvdptqvdnlrwsrgdddtlrpmlarltvdadgrtantpgfdarrvrqwgyna
    andpqaiylnyigsaggvfqrdgkfafdnpgaieafrylvglinddhvappasdtndngd
    fsrnqflagkmalfqsgtyslapvardalfhwgvamlpagpagrvsvtngiaaagnsask
    hpdavrqvlawmgstegnsylgrhgaaipavlsaqpvyfdywsargvdvtpffavlngpr
    iaapggagfaagqqalepyfdemflgrgdvtttlrqaqaaanaatqrklaaale