PDB entry 5k2i

View 5k2i on RCSB PDB site
Description: Crystal structure of Oxidized Prx3 from Vibrio vulnificus
Class: oxidoreductase
Keywords: 1-Cys Prx, Vibrio vulnificus, hydrogen peroxide, nitric oxide, OXIDOREDUCTASE
Deposited on 2016-05-19, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-Cys peroxiredoxin
    Species: Vibrio vulnificus MO6-24/O [TaxId:914127]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K2I (0-End)
    Domains in SCOPe 2.07: d5k2ia1, d5k2ia2
  • Chain 'B':
    Compound: 1-Cys peroxiredoxin
    Species: Vibrio vulnificus MO6-24/O [TaxId:914127]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K2I (0-End)
    Domains in SCOPe 2.07: d5k2ib1, d5k2ib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k2iA (A:)
    miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptcseahlpgyivla
    dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
    rsqryamiidngvvttlnveapksfevsnaetilaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k2iA (A:)
    miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptcseahlpgyivla
    dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
    rsqryamiidngvvttlnveapksfevsnaetilaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k2iB (B:)
    miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptcseahlpgyivla
    dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
    rsqryamiidngvvttlnveapksfevsnaetilaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k2iB (B:)
    miaqgqtlpnatlsqltkegmvhhpvlelfagkkvvlfavpgaftptcseahlpgyivla
    dqlkakgvdliasvsvndafvmkawgeaqnaeeilmladgdasftkalglemdtagfggl
    rsqryamiidngvvttlnveapksfevsnaetilaal