PDB entry 5k2b

View 5k2b on RCSB PDB site
Description: 2.5 angstrom a2a adenosine receptor structure with mr phasing using xfel data
Deposited on 2016-05-18, released 2016-09-21
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine receptor A2a/Soluble cytochrome b562 chimera
    Species: Homo sapiens, Escherichia coli [TaxId:9606, 562]
    Gene: ADORA2A, ADORA2, cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29274 (26-232)
      • expression tag (22-25)
    • Uniprot P0ABE7 (233-338)
      • engineered mutation (239)
      • engineered mutation (334)
      • engineered mutation (338)
    • Uniprot P29274 (339-End)
  • Heterogens: ZMA, NA, CLR, OLB, OLC, OLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k2bA (A:)
    mktiialsyifclvfadykddddgappimgssvyitvelaiavlailgnvlvcwavwlns
    nlqnvtnyfvvslaaadiavgvlaipfaitistgfcaachgclfiacfvlvltqssifsl
    laiaidryiairiplrynglvtgtrakgiiaicwvlsfaigltpmlgwnncgqpkegknh
    sqgcgegqvaclfedvvpmnymvyfnffacvlvplllmlgvylriflaarrqladlednw
    etlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkdfrhgfdi
    lvgqiddalklanegkvkeaqaaaeqlkttrnayiqkylerarstlqkevhaakslaiiv
    glfalcwlplhiincftffcpdcshaplwlmylaivlshtnsvvnpfiyayrirefrqtf
    rkiirshvlrqqepfkahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5k2bA (A:)
    dgappimgssvyitvelaiavlailgnvlvcwavwlnsnlqnvtnyfvvslaaadiavgv
    laipfaitistgfcaachgclfiacfvlvltqssifsllaiaidryiairiplrynglvt
    gtrakgiiaicwvlsfaigltpmlgwnncgqpkegknhsqgcgegqvaclfedvvpmnym
    vyfnffacvlvplllmlgvylriflaarrqladlednwetlndnlkviekadnaaqvkda
    ltkmraaaldaqkaemkdfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayi
    qkylerarstlqkevhaakslaiivglfalcwlplhiincftffcpdcshaplwlmylai
    vlshtnsvvnpfiyayrirefrqtfrkiirshvl