PDB entry 5k28

View 5k28 on RCSB PDB site
Description: Structure of the unbound SH3 domain of MLK3
Class: transferase
Keywords: MLK3, SH3, phage display, signalling protein, TRANSFERASE
Deposited on 2016-05-18, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 11
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K11, MLK3, PTK1, SPRK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16584 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5k28a1, d5k28a2
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase 11
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K11, MLK3, PTK1, SPRK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16584 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5k28b1, d5k28b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k28A (A:)
    hmpvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvs
    rggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k28A (A:)
    hmpvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvs
    rg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k28B (B:)
    hmpvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvs
    rggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k28B (B:)
    hmpvwtalfdyepsgqdelalrkgdrvevlsrdaaisgdegwwagqvggqvgifpsnyvs
    rg