PDB entry 5k27

View 5k27 on RCSB PDB site
Description: crystal structure of ancestral protein ancmt of adp-dependent sugar kinases family.
Deposited on 2016-05-18, released 2017-05-24
The last revision was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ancMT
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K27 (Start-471)
  • Chain 'B':
    Compound: ancMT
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K27 (Start-471)
  • Heterogens: AMP, IOD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k27A (A:)
    mgsshhhhhhssgenlyfqghmedikkisiflaynvnvdaikylkeediqklieefgeee
    iiekieeyprkikepldfvarlihaiktgkpaevpldneelnkwfdslfkydeermggqv
    giianllaildlkkviayspllskkqaemfnndllypivengklvlkkpieaykdndpik
    inrifefkegikfklgdekiiapqanrfivasrpenlarieikedlkkylpeigemvdca
    ilsgyqgikekysdgktaeyyfkrakedikllkkkdikvhlefasiqnikirkkvvdyil
    pnvdsvgmdeteianilnilgyeelsekilkdskiedviegakilldkfnlevvqvhtiy
    yilfiskkdnplskeelkktlefatilaatkaklgdikniedlkvglkvphnkygellke
    iveklkkkkkkedykivlipsrfvenpkstvglgdtistgafvsyvsllkkk
    

    Sequence, based on observed residues (ATOM records):
    >5k27A (A:)
    ghmedikkisiflaynvnvdaikylkeediqklieefgeeeiiekieeyprkikepldfv
    arlihaiktgkpaevpldneelnkwfdslfkydeermggqvgiianllaildlkkviays
    pllskkqaemfnndllypivengklvlkkpieaykdndpikinrifefkegikfklgdek
    iiapqanrfivasrpenlarieikedlkkylpeigemvdcailsgyqgikekysdgktae
    yyfkrakedikllkkkdikvhlefasiqnikirkkvvdyilpnvdsvgmdeteianilni
    lgyeelsekilkdskiedviegakilldkfnlevvqvhtiyyilfiskkdnplskeelkk
    tlefatilaatkaklgdikniedlkvglkvphnkygellkeiveklkkkkkkedykivli
    psrfvenpkstvglgdtistgafvsyvsllkkk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k27B (B:)
    mgsshhhhhhssgenlyfqghmedikkisiflaynvnvdaikylkeediqklieefgeee
    iiekieeyprkikepldfvarlihaiktgkpaevpldneelnkwfdslfkydeermggqv
    giianllaildlkkviayspllskkqaemfnndllypivengklvlkkpieaykdndpik
    inrifefkegikfklgdekiiapqanrfivasrpenlarieikedlkkylpeigemvdca
    ilsgyqgikekysdgktaeyyfkrakedikllkkkdikvhlefasiqnikirkkvvdyil
    pnvdsvgmdeteianilnilgyeelsekilkdskiedviegakilldkfnlevvqvhtiy
    yilfiskkdnplskeelkktlefatilaatkaklgdikniedlkvglkvphnkygellke
    iveklkkkkkkedykivlipsrfvenpkstvglgdtistgafvsyvsllkkk
    

    Sequence, based on observed residues (ATOM records):
    >5k27B (B:)
    medikkisiflaynvnvdaikylkeediqklieefgeeeiiekieeyprkikepldfvar
    lihaiktgkpaevpldneelnkwfdslfkydeermggqvgiianllaildlkkviayspl
    lskkqaemfnndllypivengklvlkkpieaykdndpikinrifefkegikfklgdekii
    apqanrfivasrplarieikedlkkylpeigemvdcailsgyqgikekysdgktaeyyfk
    rakedikllkkkdikvhlefasiqnikirkkvvdyilpnvdsvgmdeteianilnilgye
    elsekilkdskiedviegakilldkfnlevvqvhtiyyilfiskkdnplskeelkktlef
    atilaatkaklgdikniedlkvglkvphnkygellkeiveklkkkkkkedykivlipsrf
    venpkstvglgdtistgafvsyvsllkkk