PDB entry 5k23

View 5k23 on RCSB PDB site
Description: Crystal structure of the complex between human phosphatase PRL-2 in the oxidized state with the Bateman domain of human magnesium transporter CNNM3
Class: hydrolase/transporter protein/protein binding
Keywords: Complex, phosphatase, magnesium transporter, protein binding, HYDROLASE, HYDROLASE-TRANSPORTER PROTEIN-PROTEIN BINDING complex
Deposited on 2016-05-18, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine phosphatase type IVA 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP4A2, PRL2, PTPCAAX2, BM-008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k23a_
  • Chain 'C':
    Compound: Metal transporter CNNM3
    Species: Homo sapiens [TaxId:9606]
    Gene: CNNM3, ACDP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NE01 (11-End)
      • expression tag (0-10)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k23A (A:)
    msyyhhhhhhlestslykkagfmnrpapveisyenmrflithnptnatlnkfteelkkyg
    vttlvrvcdatydkapvekegihvldwpfddgapppnqivddwlnllktkfreepgccva
    vhcvaglgrapvlvalaliecgmkyedavqfirqkrrgafnskqllylekyrpkmrlrfr
    dtnghccvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k23A (A:)
    mnrpapveisyenmrflithnptnatlnkfteelkkygvttlvrvcdatydkapvekegi
    hvldwpfddgapppnqivddwlnllktkfreepgccvavhcvaglgrapvlvalaliecg
    mkyedavqfirqkrrgafnskqllylekyrpkmrlr
    

  • Chain 'C':
    No sequence available.