PDB entry 5k1v

View 5k1v on RCSB PDB site
Description: Crystal structure of Endoplasmic Reticulum aminopeptidase 2 (ERAP2) in complex with a diaminobenzoic acid derivative ligand.
Class: hydrolase
Keywords: Endoplasmic Reticulum aminopeptidase, hydrolase, zinc-binding metallopeptidase, diaminobenzoic acid derivative
Deposited on 2016-05-18, released 2017-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum aminopeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP2, LRAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P179 (Start-959)
      • expression tag (960-963)
    Domains in SCOPe 2.08: d5k1va1, d5k1va2, d5k1va3, d5k1va4, d5k1va5
  • Chain 'B':
    Compound: Endoplasmic reticulum aminopeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP2, LRAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k1vb1, d5k1vb2, d5k1vb3
  • Heterogens: ZN, 6PX, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k1vA (A:)
    mfhssamvnshrkpmfnihrgfycltailpqicicsqfsvpssyhftedpgafpvatnge
    rfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskdleitna
    tlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfy
    kstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvk
    tielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyal
    qaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasd
    klwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnv
    cfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiq
    ylkkfsyrnaknddlwsslsnsclesdftsggvchsdpkmtsnmlaflgenaevkemmtt
    wtlqkgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvi
    hrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrv
    glihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdise
    nlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmes
    sgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllkl
    ielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisg
    ttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvnt
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k1vA (A:)
    pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk
    dleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklg
    dgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhial
    snmpkvktielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkr
    nqthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdp
    ktssasdklwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqf
    ddyflnvcfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeek
    fqkgiiqylkkfsyrnaknddlwsslsnscgvchsmtsnmlaflgenaevkemmttwtlq
    kgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhi
    lksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrvglih
    dvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdisenlkr
    yllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmessgkl
    niptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllklielg
    megkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisgttah
    fsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvntrhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k1vB (B:)
    mfhssamvnshrkpmfnihrgfycltailpqicicsqfsvpssyhftedpgafpvatnge
    rfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskdleitna
    tlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfy
    kstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvk
    tielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyal
    qaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasd
    klwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnv
    cfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiq
    ylkkfsyrnaknddlwsslsnsclesdftsggvchsdpkmtsnmlaflgenaevkemmtt
    wtlqkgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvi
    hrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrv
    glihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdise
    nlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmes
    sgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllkl
    ielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisg
    ttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvnt
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k1vB (B:)
    pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk
    dleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklg
    dgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhial
    snmpkvktielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkr
    nqthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdp
    ktssasdklwvtrviahelahqwfgnlvtmewwndiwlkegfakymeliavnatypelqf
    ddyflnvcfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeek
    fqkgiiqylkkfsyrnaknddlwsslsngenaevkemmttwtlqkgiplqqerflqeryl
    whipltyvihrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnh
    tllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmd
    rrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaa
    elfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalsts
    khqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgs
    ydirmiisgttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlpt
    lrtwlmvnt