PDB entry 5k1h

View 5k1h on RCSB PDB site
Description: eif3b relocated to the intersubunit face to interact with eif1 and below the eif2 ternary-complex. from the structure of a partial yeast 48s preinitiation complex in closed conformation.
Deposited on 2016-05-18, released 2016-07-13
The last revision was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: EM
Resolution: 4.9 Å
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eIF3a C-terminal tail
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K1H (0-53)
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 3 subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF3B, EIF3S9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55884 (0-575)
      • conflict (330)
      • conflict (426)
      • conflict (433)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5k1hA (A:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k1hB (B:)
    gdvlkdrpqeadgidsvivvdnvpqvgpdrleklknvihkifskfgkitndfypeedgkt
    kgyifleyaspahavdavknadgykldkqhtfrvnlftdfdkymtisdewdipekqpfkd
    lgnlrywleeaecrdqysvifesgdrtsifwndvkdpvsieerarwtetyvrwspkgtyl
    atfhqrgialwggekfkqiqrfshqgvqlidfspcerylvtfsplmdtqddpqaiiiwdi
    ltghkkrgfhcessahwpifkwshdgkffarmtldtlsiyetpsmglldkkslkisgikd
    fswspggniiafwvpedkdiparvtlmqlpsrqeirvrnlfnvvdcklhwqkngdylcvk
    vdrtpkgtqgvvtnfeifrmrekqvpvdvvemketiiafawepngskfavlhgeaprisv
    sfyhvksngkielskmfdkqqantifwspqgqfvvlaglrsmngalafvdtsdctvmnia
    ehymasdvewdptgryvvtsvswwshkvdnaywlwtfqgrllqknnkdrfcqllwrprpp
    tllsqeqikqikkdlkkyskifeqkdrlsqskaske
    

    Sequence, based on observed residues (ATOM records):
    >5k1hB (B:)
    gdvlkdrpqeadgidsvivvdnvpqvgpdrleklknvihkifskfgkitndfypeedgkt
    kgyifleyaspahavdavknadgykldkqhtfrvnlftdfdkymtisdewdipekqpfkd
    lgnlrywleeaecrdqysvifesgdrtsifwndvkdpvsieerarwtetyvrwspkgtyl
    atfhqrgialwggekfkqiqrfshqgvqlidfspcerylvtfsplmdtqddpqaiiiwdi
    ltghkkrgfhcessahwpifkwshdgkffarmtldtlsiyetpsmglldkkslkisgikd
    fswspggniiafwvpedkdiparvtlmqlpsrqeirvrnlfnvvdcklhwqkngdylcvk
    vdrtpkgtqgvvtnfeifrmrekqvpvdvvemketiiafawepngskfavlhgeaprisv
    sfyhvksngkielskmfdkqqantifwspqgqfvvlaglrsmngalafvdtsdctvmnia
    ehymasdvewdptgryvvtsvswwshkvdnaywlwtfqgrllqknnkdrfcqllwrprif
    eqkdrlsqskaske