PDB entry 5k1c

View 5k1c on RCSB PDB site
Description: Crystal structure of the UAF1/WDR20/USP12 complex
Class: hydrolase
Keywords: WD40 repeat domain, WDR20, USP12, UAF1, WDR48, deubiquitinating enzyme, Ubiquitin-specific protease, USP1-associated factor 1, HYDROLASE
Deposited on 2016-05-18, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: USP12, UBH1, USP12L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k1ca_
  • Chain 'B':
    Compound: WD repeat-containing protein 48
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR48, KIAA1449, UAF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: WD repeat-containing protein 20
    Species: Homo sapiens [TaxId:9606]
    Gene: WDR20
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, PO4, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k1cA (A:)
    mganasalekeigpeqfpvnehyfglvnfgntcycnsvlqalyfcrpfrekvlayksqpr
    kkeslltcladlfhsiatqkkkvgvippkkfitrlrkenelfdnymqqdaheflnyllnt
    iadilqeerkqekqngrlpngnidnennnstpdptwvheifqgtltnetrcltcetissk
    dedfldlsvdveqntsithclrgfsntetlcseykyyceecrskqeahkrmkvkklpmil
    alhlkrfkymdqlhrytklsyrvvfplelrlfntsgdatnpdrmydlvavvvhcgsgpnr
    ghyiaivkshdfwllfdddivekidaqaieefygltsdisknsesgyilfyqsrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k1cA (A:)
    hyfglvnfgntcycnsvlqalyfcrpfrekvlayslltcladlfhsiatqvippkkfitr
    lrkenelfdnymqqdaheflnyllntiadilqeerkqepdptwvheifqgtltnetrclt
    cetisskdedfldlsvdveqntsithclrgfsntetlcseykyyceecrskqeahkrmkv
    kklpmilalhlkrfkymdqlhrytklsyrvvfplelrlfntsgdatnpdrmydlvavvvh
    cgsgpnrghyiaivkshdfwllfdddivekidaqaieefygltsdisknsesgyilfyqs
    rd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.