PDB entry 5k16

View 5k16 on RCSB PDB site
Description: Crystal structure of free Ubiquitin-specific protease 12
Class: hydrolase
Keywords: deubiquitination, deubiquitnating enzyme, DUB, HYDROLASE
Deposited on 2016-05-17, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: USP12, UBH1, USP12L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k16a_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 12
    Species: Homo sapiens [TaxId:9606]
    Gene: USP12, UBH1, USP12L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k16b_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k16A (A:)
    mganasalekeigpeqfpvnehyfglvnfgntcycnsvlqalyfcrpfrekvlayksqpr
    kkeslltcladlfhsiatqkkkvgvippkkfitrlrkenelfdnymqqdaheflnyllnt
    iadilqeerkqekqngrlpngnidnennnstpdptwvheifqgtltnetrcltcetissk
    dedfldlsvdveqntsithclrgfsntetlcseykyyceecrskqeahkrmkvkklpmil
    alhlkrfkymdqlhrytklsyrvvfplelrlfntsgdatnpdrmydlvavvvhcgsgpnr
    ghyiaivkshdfwllfdddivekidaqaieefygltsdisknsesgyilfyqsrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k16A (A:)
    salekeigpeqfpvnehyfglvnfgntcycnsvlqalyfcrpfrekvlayksqkkesllt
    cladlfhsiatqkkkvgvippkkfitrlrkenelfdnymqqdaheflnyllntiadilqe
    erkqekqnpdptwvheifqgtltnetrcltcetisskdedfldlsvdveqntsithclrg
    fsntetkyyceecrskqeahkrmkvkklpmilalhlkrfkymdqlhrytklsyrvvfple
    lrlfntsgdatnpdrmydlvavvvhcgsgpnrghyiaivkshdfwllfdddivekidaqa
    ieefygltsknsesgyilfyqsrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k16B (B:)
    mganasalekeigpeqfpvnehyfglvnfgntcycnsvlqalyfcrpfrekvlayksqpr
    kkeslltcladlfhsiatqkkkvgvippkkfitrlrkenelfdnymqqdaheflnyllnt
    iadilqeerkqekqngrlpngnidnennnstpdptwvheifqgtltnetrcltcetissk
    dedfldlsvdveqntsithclrgfsntetlcseykyyceecrskqeahkrmkvkklpmil
    alhlkrfkymdqlhrytklsyrvvfplelrlfntsgdatnpdrmydlvavvvhcgsgpnr
    ghyiaivkshdfwllfdddivekidaqaieefygltsdisknsesgyilfyqsrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k16B (B:)
    nasalekeigpeqfpvnehyfglvnfgntcycnsvlqalyfcrpfrekvlayksqprkke
    slltcladlfhsiatqkkkvgvippkkfitrlrkenelfdnymqqdaheflnyllntiad
    ilqeerkqekqptwvheifqgtltnetrcltcetisskdedfldlsvdveqntsithclr
    gfsntetlcseykyyceecrskqeahkrmkvkklpmilalhlkrfkymdqlhrytklsyr
    vvfplelrlfntsgdatnpdrmydlvavvvhcgsgpnrghyiaivkshdfwllfdddive
    kidaqaieefyglknsesgyilfyqsrd