PDB entry 5k0z

View 5k0z on RCSB PDB site
Description: Cryo-EM structure of lactate dehydrogenase (LDH) in inhibitor-bound state
Class: oxidoreductase
Keywords: lactate dehydrogenase, small metabolic complex, small molecule inhibitor, OXIDOREDUCTASE
Deposited on 2016-05-17, released 2016-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase B chain
    Species: Gallus gallus [TaxId:9031]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k0za1, d5k0za2
  • Chain 'B':
    Compound: L-lactate dehydrogenase B chain
    Species: Gallus gallus [TaxId:9031]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k0zb1, d5k0zb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase B chain
    Species: Gallus gallus [TaxId:9031]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k0zc1, d5k0zc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase B chain
    Species: Gallus gallus [TaxId:9031]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k0zd1, d5k0zd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k0zA (A:)
    atlkeklitpvaagstvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkge
    mmdlqhgslflqthkivadkdyavtanskivvvtagvrqqegesrlnlvqrnvnvfkfii
    pqivkyspnctilvvsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgih
    ptschgwilgehgdssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayev
    irlkgytnwaiglsvaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasglt
    svinqklkddevaqlkksadtlwsiqkdlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k0zA (A:)
    atlkeklitpvtvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkgemmdl
    qhgslflqthkivadkdyavtanskivvvtagvlvqrnvnvfkfiipqivkyspnctilv
    vsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgihptschgwilgehgd
    ssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayevirlkgytnwaigls
    vaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasgltsvinqklkddevaq
    lkksadtlwsiqkdlkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k0zB (B:)
    atlkeklitpvaagstvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkge
    mmdlqhgslflqthkivadkdyavtanskivvvtagvrqqegesrlnlvqrnvnvfkfii
    pqivkyspnctilvvsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgih
    ptschgwilgehgdssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayev
    irlkgytnwaiglsvaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasglt
    svinqklkddevaqlkksadtlwsiqkdlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k0zB (B:)
    atlkeklitpvtvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkgemmdl
    qhgslflqthkivadkdyavtanskivvvtagvlvqrnvnvfkfiipqivkyspnctilv
    vsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgihptschgwilgehgd
    ssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayevirlkgytnwaigls
    vaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasgltsvinqklkddevaq
    lkksadtlwsiqkdlkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k0zC (C:)
    atlkeklitpvaagstvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkge
    mmdlqhgslflqthkivadkdyavtanskivvvtagvrqqegesrlnlvqrnvnvfkfii
    pqivkyspnctilvvsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgih
    ptschgwilgehgdssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayev
    irlkgytnwaiglsvaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasglt
    svinqklkddevaqlkksadtlwsiqkdlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k0zC (C:)
    atlkeklitpvtvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkgemmdl
    qhgslflqthkivadkdyavtanskivvvtagvlvqrnvnvfkfiipqivkyspnctilv
    vsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgihptschgwilgehgd
    ssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayevirlkgytnwaigls
    vaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasgltsvinqklkddevaq
    lkksadtlwsiqkdlkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k0zD (D:)
    atlkeklitpvaagstvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkge
    mmdlqhgslflqthkivadkdyavtanskivvvtagvrqqegesrlnlvqrnvnvfkfii
    pqivkyspnctilvvsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgih
    ptschgwilgehgdssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayev
    irlkgytnwaiglsvaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasglt
    svinqklkddevaqlkksadtlwsiqkdlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k0zD (D:)
    atlkeklitpvtvpsnkitvvgvgqvgmacaisilgkglcdelalvdvledklkgemmdl
    qhgslflqthkivadkdyavtanskivvvtagvlvqrnvnvfkfiipqivkyspnctilv
    vsnpvdiltyvtwklsglpkhrvigsgcnldtarfrylmaerlgihptschgwilgehgd
    ssvavwsgvnvagvslqelnpamgtdkdsenwkevhkqvvesayevirlkgytnwaigls
    vaelcetmlknlyrvhsvstlvkgtygiendvflslpcvlsasgltsvinqklkddevaq
    lkksadtlwsiqkdlkd