PDB entry 5k0a

View 5k0a on RCSB PDB site
Description: structure of an oxidoreductase from synechocystis sp. pcc6803
Deposited on 2016-05-17, released 2017-11-15
The last revision was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.7100000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Slr0600 protein
    Species: Synechocystis sp. [TaxId:1111708]
    Gene: slr0600
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74746 (Start-329)
      • microheterogeneity (156)
      • conflict (243)
  • Chain 'B':
    Compound: Slr0600 protein
    Species: Synechocystis sp. [TaxId:1111708]
    Gene: slr0600
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74746 (Start-329)
      • microheterogeneity (156)
      • conflict (243)
  • Chain 'C':
    Compound: Slr0600 protein
    Species: Synechocystis sp. [TaxId:1111708]
    Gene: slr0600
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74746 (Start-329)
      • microheterogeneity (156)
      • conflict (243)
  • Chain 'D':
    Compound: Slr0600 protein
    Species: Synechocystis sp. [TaxId:1111708]
    Gene: slr0600
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74746 (Start-329)
      • microheterogeneity (156)
      • conflict (243)
  • Heterogens: FAD, NO3, PG4, 1PE, PO4, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k0aA (A:)
    gshmvklssknldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqd
    lrnyvgldpdtpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslyp
    ifrtkyviaatgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqi
    naafvlnwftpyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvd
    gtvmeattglinmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnq
    vsvavadgtlaatqiwrnirraseprkwih
    

    Sequence, based on observed residues (ATOM records):
    >5k0aA (A:)
    nldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqdlrnyvgldpd
    tpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslypifrtkyviaa
    tgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqinaafvlnwft
    pyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvdgtvmeattgl
    inmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnqvsvavadgtl
    aatqiwrnirraseprkwih
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k0aB (B:)
    gshmvklssknldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqd
    lrnyvgldpdtpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslyp
    ifrtkyviaatgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqi
    naafvlnwftpyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvd
    gtvmeattglinmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnq
    vsvavadgtlaatqiwrnirraseprkwih
    

    Sequence, based on observed residues (ATOM records):
    >5k0aB (B:)
    knldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqdlrnyvgldp
    dtpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslypifrtkyvia
    atgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqinaafvlnwf
    tpyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvdgtvmeattg
    linmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnqvsvavadgt
    laatqiwrnirraseprkwih
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k0aC (C:)
    gshmvklssknldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqd
    lrnyvgldpdtpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslyp
    ifrtkyviaatgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqi
    naafvlnwftpyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvd
    gtvmeattglinmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnq
    vsvavadgtlaatqiwrnirraseprkwih
    

    Sequence, based on observed residues (ATOM records):
    >5k0aC (C:)
    tvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqdlrnyvgldpdtpgrdii
    thstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslypifrtkyviaatgiidnl
    pqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqinaafvlnwftpyitvlt
    hglctvgdemkakladhgyplheaaitkflgedhkmsgvelvdgtvmeattglinmgsvy
    hnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnqvsvavadgtlaatqiwr
    nirraseprkwih
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5k0aD (D:)
    gshmvklssknldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqd
    lrnyvgldpdtpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslyp
    ifrtkyviaatgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqi
    naafvlnwftpyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvd
    gtvmeattglinmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnq
    vsvavadgtlaatqiwrnirraseprkwih
    

    Sequence, based on observed residues (ATOM records):
    >5k0aD (D:)
    sknldarldtvydaivlgggmgglsaaiylaryglkclvvekgrgrsfwmqdlrnyvgld
    pdtpgrdiithstqqalhwgadllrgyvedvtdegdtlavkvkvgkkdslypifrtkyvi
    aatgiidnlpqledmqnvydyagytlhvcmicdgfdmwdqkavliagtegqinaafvlnw
    ftpyitvlthglctvgdemkakladhgyplheaaitkflgedhkmsgvelvdgtvmeatt
    glinmgsvyhnhylkgieglewdgenlvtndmaqtshprifalgdlkkglnqvsvavadg
    tlaatqiwrnirraseprkwih