PDB entry 5jzw

View 5jzw on RCSB PDB site
Description: cryo-em structures of aerolysin post-prepore and quasipore
Deposited on 2016-05-17, released 2016-07-13
The last revision was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: EM
Resolution: 4.46 Å
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Aerolysin
    Species: Aeromonas hydrophila [TaxId:644]
    Gene: aerA
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jzwA (A:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwA (A:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jzwB (B:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwB (B:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jzwC (C:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwC (C:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jzwD (D:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwD (D:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jzwE (E:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwE (E:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jzwF (F:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwF (F:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5jzwG (G:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwG (G:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnggstttslsqsvrp
    tvparskipvkielykadisypyefkadvsydltlsgflrwggnawythpdnrpnwnhtf
    vigpykdkassiryqwdkryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgd
    fsaesqfagnieigapvplaa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5jzwH (H:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwH (H:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5jzwI (I:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwI (I:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5jzwJ (J:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwJ (J:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5jzwK (K:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwK (K:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5jzwL (L:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwL (L:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5jzwM (M:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwM (M:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5jzwN (N:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvt
    tknkfcwplvgetelsiciaanqswasqnggstttslsqsvrptvparskipvkielyka
    disypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwd
    kryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapv
    plaa
    

    Sequence, based on observed residues (ATOM records):
    >5jzwN (N:)
    aepvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpg
    yngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsyla
    hylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynld
    pdsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglseanq
    swasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflr
    wggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqngls
    tmqnnlarvlrpvragitgdfsaesqfagnieigapvplaa