PDB entry 5jzv

View 5jzv on RCSB PDB site
Description: The structure of D77G hCINAP-ADP
Class: transferase
Keywords: ATPase, adenylate kinase, transferase
Deposited on 2016-05-17, released 2016-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate kinase isoenzyme 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AK6, CINAP, AD-004, CGI-137
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3D8 (34-205)
      • expression tag (31-33)
      • engineered mutation (110)
    Domains in SCOPe 2.06: d5jzva1, d5jzva2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jzvA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmllpnilltgtpgvgkttlgkelask
    sglkyinvgdlareeqlydgydeeydcpildedrvvdeldnqmreggvivgyhgcdffpe
    rwfhivfvlrtdtnvlyerletrgynekkltdniqceifqvlyeeatasykeeivhqlps
    nkpeelennvdqilkwieqwikdhns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jzvA (A:)
    rgsmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpild
    edrvvdeldnqmreggvivgyhgcdffperwfhivfvlrtdtnvlyerletrgynekklt
    dniqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns