PDB entry 5jzu

View 5jzu on RCSB PDB site
Description: aspartyl/asparaginyl beta-hydroxylase (asph)oxygenase and tpr domains in complex with manganese, n-oxalylglycine and factor x substrate peptide fragment (26mer)
Deposited on 2016-05-17, released 2017-06-07
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartyl/asparaginyl beta-hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: ASPH, BAH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: coagulation factor x
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, OGA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jzuA (A:)
    kpkllnkfdktikaeldaaeklrkrgkieeavnafkelvrkypqsprarygkaqceddla
    ekrrsnevlrgaietyqevaslpdvpadllklslkrrsdrqqflghmrgslltlqrlvql
    fpndtslkndlgvgylligdndnakkvyeevlsvtpndgfakvhygfilkaqnkiaesip
    ylkegiesgdpgtddgrfyfhlgdamqrvgnkeaykwyelghkrghfasvwqrslynvng
    lkaqpwwtpketgytelvkslernwklirdeglavmdkakglflpedenlrekgdwsqft
    lwqqgrrnenackgapktctllekfpettgcrrgqikysimhpgthvwphtgptncrlrm
    hlglvipkegckircanetktweegkvlifddsfehevwqdassfrlifivdvwhpeltp
    qqrrslpai
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jzuB (B:)
    dgdqcetspcqnqgkckdglgeytct
    

    Sequence, based on observed residues (ATOM records):
    >5jzuB (B:)
    gkckdglgeytct