PDB entry 5jzo

View 5jzo on RCSB PDB site
Description: structure of wild type amidase at high temperature at 2.5 angstrom resolution
Deposited on 2016-05-17, released 2016-06-15
The last revision was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular protease/amidase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_0351, VC395_A0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Intracellular protease/amidase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_0351, VC395_A0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Intracellular protease/amidase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_0351, VC395_A0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Intracellular protease/amidase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_0351, VC395_A0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Intracellular protease/amidase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_0351, VC395_A0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Intracellular protease/amidase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_0351, VC395_A0912
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jzoA (A:)
    gsmttvmndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvga
    derylmmdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqev
    nglyskyqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwam
    kqnkfiislchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlq
    aigfellntgisgqvfqdrkmltgdsplagnalgqlaakallaeveqk
    

    Sequence, based on observed residues (ATOM records):
    >5jzoA (A:)
    mndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvgaderylm
    mdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqevnglysk
    yqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwamkqnkfi
    islchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlqaigfel
    lntgisgqvfqdrkmltgdsplagnalgqlaakallaeveq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jzoB (B:)
    gsmttvmndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvga
    derylmmdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqev
    nglyskyqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwam
    kqnkfiislchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlq
    aigfellntgisgqvfqdrkmltgdsplagnalgqlaakallaeveqk
    

    Sequence, based on observed residues (ATOM records):
    >5jzoB (B:)
    mndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvgaderylm
    mdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqevnglysk
    yqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwamkqnkfi
    islchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlqaigfel
    lntgisgqvfqdrkmltgdsplagnalgqlaakallaeveq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jzoC (C:)
    gsmttvmndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvga
    derylmmdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqev
    nglyskyqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwam
    kqnkfiislchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlq
    aigfellntgisgqvfqdrkmltgdsplagnalgqlaakallaeveqk
    

    Sequence, based on observed residues (ATOM records):
    >5jzoC (C:)
    mndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvgaderylm
    mdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqevnglysk
    yqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwamkqnkfi
    islchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlqaigfel
    lntgisgqvfqdrkmltgdsplagnalgqlaakallaeveq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jzoD (D:)
    gsmttvmndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvga
    derylmmdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqev
    nglyskyqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwam
    kqnkfiislchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlq
    aigfellntgisgqvfqdrkmltgdsplagnalgqlaakallaeveqk
    

    Sequence, based on observed residues (ATOM records):
    >5jzoD (D:)
    mndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvgaderylm
    mdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqevnglysk
    yqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwamkqnkfi
    islchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlqaigfel
    lntgisgqvfqdrkmltgdsplagnalgqlaakallaeveq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jzoE (E:)
    gsmttvmndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvga
    derylmmdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqev
    nglyskyqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwam
    kqnkfiislchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlq
    aigfellntgisgqvfqdrkmltgdsplagnalgqlaakallaeveqk
    

    Sequence, based on observed residues (ATOM records):
    >5jzoE (E:)
    mndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvgaderylm
    mdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqevnglysk
    yqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwamkqnkfi
    islchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlqaigfel
    lntgisgqvfqdrkmltgdsplagnalgqlaakallaeveq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jzoF (F:)
    gsmttvmndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvga
    derylmmdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqev
    nglyskyqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwam
    kqnkfiislchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlq
    aigfellntgisgqvfqdrkmltgdsplagnalgqlaakallaeveqk
    

    Sequence, based on observed residues (ATOM records):
    >5jzoF (F:)
    mndkhptpdpaednaffpsayslsqftasksdlsgahyptpyqggrwkilvvgaderylm
    mdngtffstgnhpvetllpmyhldkagfsfdiatlsgnpvkfewwampredqevnglysk
    yqssfrqplklsdvietalgedsdyigvfipgghgalmglpdsqevkavlqwamkqnkfi
    islchgpaaflavgddplfagykivafpdemdaqtpsigympghltwkfgeqlqaigfel
    lntgisgqvfqdrkmltgdsplagnalgqlaakallaeveq