PDB entry 5jyy

View 5jyy on RCSB PDB site
Description: Structure-based Tetravalent Zanamivir with Potent Inhibitory Activity against Drug-resistant Influenza Viruses
Class: hydrolase/hydrolase inhibitor
Keywords: neuraminidase inhibitor, tetravalent Zanamivir, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-05-15, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene: NA
    Database cross-references and differences (RAF-indexed):
    • Uniprot R4NFR6 (0-387)
      • see sequence details (211)
    Domains in SCOPe 2.07: d5jyya_
  • Heterogens: NAG, BMA, MAN, CA, 6PY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jyyA (A:)
    rnfnnltkglctinswhiygkdnavrigessdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgksrmsicisgpnnn
    asavvwynrrpvaeintwarnilrtqesecvchngvcpvvftdgsatgpadtriyyfkeg
    kilkwesltgtakhieecscygertgitctckdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndpnigkcndpypgnnnngvkgfsyldgantwlgrtistasrsgyemlkvpn
    altddrskpiqgqtivlnadwsgysgsfmdywaegdcyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl