PDB entry 5jyn

View 5jyn on RCSB PDB site
Description: structure of the transmembrane domain of hiv-1 gp41 in bicelle
Deposited on 2016-05-14, released 2016-06-29
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jynA (A:)
    nwlwyirifiiivgsliglrivfavlslvnrvrqgyspls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5jynB (B:)
    nwlwyirifiiivgsliglrivfavlslvnrvrqgyspls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5jynC (C:)
    nwlwyirifiiivgsliglrivfavlslvnrvrqgyspls