PDB entry 5jy8

View 5jy8 on RCSB PDB site
Description: an iron-bound structure of the isochorismate synthase entc
Deposited on 2016-05-13, released 2016-07-20
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isochorismate synthase entC
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: entC, Z0735, ECs0632
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Isochorismate synthase entC
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: entC, Z0735, ECs0632
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, ISJ

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jy8A (A:)
    mdtslaeevqqtmatlapnrfffmspyrsfttsgcfarfdepavngdspdspfqqklaal
    fadakaqgiknpvmvgaipfdprqpsslyipeswqsfsrqekqasarrftrsqslnvver
    qaipeqttfeqmvaraaaltatpqvdkvvlsrlidittdaaidsgvllerliaqnpvsyn
    fhvpladggvllgaspelllrkdgerfssiplagsarrqpdevldreagnrllasekdrh
    ehelvtqamkevlrersselhvpsspqlittptlwhlatpfegkansqenaltlacllhp
    tpalsgfphqaatqviaelepfdrelfggivgwcdsegngewvvtircaklrenqvrlfa
    gagivpassplgewretgvklstmlnvfglh
    

    Sequence, based on observed residues (ATOM records):
    >5jy8A (A:)
    lapnrfffmspyrsfttsgcfarfdepavngdspdspfqqklaalfadakaqgiknpvmv
    gaipfdprqpsslyipeswqsfsrqekqasaslnvverqaipeqttfeqmvaraaaltat
    pqvdkvvlsrlidittdaaidsgvllerliaqnpvsynfhvpladggvllgaspelllrk
    dgerfssiplagsarrqpdevldreagnrllasekdrhehelvtqamkevlrersselhv
    psspqlittptlwhlatpfegkansqenaltlacllhptpalsgfphqaatqviaelepf
    drelfggivgwcdsegngewvvtircaklrenqvrlfagagivpassplgewretgvkls
    tmlnvfgl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jy8B (B:)
    mdtslaeevqqtmatlapnrfffmspyrsfttsgcfarfdepavngdspdspfqqklaal
    fadakaqgiknpvmvgaipfdprqpsslyipeswqsfsrqekqasarrftrsqslnvver
    qaipeqttfeqmvaraaaltatpqvdkvvlsrlidittdaaidsgvllerliaqnpvsyn
    fhvpladggvllgaspelllrkdgerfssiplagsarrqpdevldreagnrllasekdrh
    ehelvtqamkevlrersselhvpsspqlittptlwhlatpfegkansqenaltlacllhp
    tpalsgfphqaatqviaelepfdrelfggivgwcdsegngewvvtircaklrenqvrlfa
    gagivpassplgewretgvklstmlnvfglh
    

    Sequence, based on observed residues (ATOM records):
    >5jy8B (B:)
    lapnrfffmspyrsfttsgcfarfdepavngdspdspfqqklaalfadakaqgiknpvmv
    gaipfdprqpsslyipeswqsfsrqekqasqslnvverqaipeqttfeqmvaraaaltat
    pqvdkvvlsrlidittdaaidsgvllerliaqnpvsynfhvpladggvllgaspelllrk
    dgefssiplagsarrqpdevldreagnrllasekdrhehelvtqamkevlrersselhvp
    sspqlittptlwhlatpfegkansqenaltlacllhptpalsgfphqaatqviaelepfd
    relfggivgwcdsegngewvvtircaklrenqvrlfagagivpassplgewretgvklst
    mlnvfgl