PDB entry 5jy5

View 5jy5 on RCSB PDB site
Description: Crystal structure of Thioredoxin 1 from Cryptococcus neoformans at 1.8 Angstroms resolution
Class: oxidoreductase
Keywords: Thioredoxin 1 Cryptococcus neoformans X-ray crystallography, OXIDOREDUCTASE
Deposited on 2016-05-13, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Cryptococcus neoformans var. grubii serotype A [TaxId:235443]
    Gene: CNAG_02801
    Database cross-references and differences (RAF-indexed):
    • Uniprot J9VKF2 (Start-103)
      • expression tag (104-105)
    Domains in SCOPe 2.07: d5jy5a1, d5jy5a2
  • Chain 'B':
    Compound: thioredoxin
    Species: Cryptococcus neoformans var. grubii serotype A [TaxId:235443]
    Gene: CNAG_02801
    Database cross-references and differences (RAF-indexed):
    • Uniprot J9VKF2 (Start-103)
      • expression tag (104-105)
    Domains in SCOPe 2.07: d5jy5b1, d5jy5b2
  • Heterogens: GOL, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jy5A (A:)
    mvkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeq
    ediakeaqikamptfvaykdgkvietvtgavpakinalldkvaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jy5A (A:)
    vkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeqe
    diakeaqikamptfvaykdgkvietvtgavpakinalldkvaahh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jy5B (B:)
    mvkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeq
    ediakeaqikamptfvaykdgkvietvtgavpakinalldkvaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jy5B (B:)
    vkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeqe
    diakeaqikamptfvaykdgkvietvtgavpakinalldkvaahh