PDB entry 5jy1

View 5jy1 on RCSB PDB site
Description: crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 bound to nad
Deposited on 2016-05-13, released 2016-05-25
The last revision was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0591
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0591
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0591
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: putative short-chain dehydrogenase/reductase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_C0591
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, CL, EDO, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jy1A (A:)
    mahhhhhhmglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeire
    mggrslfvktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtl
    ttslwatwwamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaas
    ewgrfnitvnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffas
    emsrfvtgetlhvdgglhlpgynsrpagikprey
    

    Sequence, based on observed residues (ATOM records):
    >5jy1A (A:)
    mglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeiremggrslfv
    ktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtlttslwatw
    wamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaasewgrfnit
    vnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffasemsrfvtg
    etlhvdgglhlpgynsrpagikprey
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jy1B (B:)
    mahhhhhhmglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeire
    mggrslfvktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtl
    ttslwatwwamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaas
    ewgrfnitvnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffas
    emsrfvtgetlhvdgglhlpgynsrpagikprey
    

    Sequence, based on observed residues (ATOM records):
    >5jy1B (B:)
    mglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeiremggrslfv
    ktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtlttslwatw
    wamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaasewgrfnit
    vnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffasemsrfvtg
    etlhvdgglhlpgynsrpagikprey
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jy1C (C:)
    mahhhhhhmglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeire
    mggrslfvktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtl
    ttslwatwwamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaas
    ewgrfnitvnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffas
    emsrfvtgetlhvdgglhlpgynsrpagikprey
    

    Sequence, based on observed residues (ATOM records):
    >5jy1C (C:)
    mglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeiremggrslfv
    ktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtlttslwatw
    wamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaasewgrfnit
    vnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffasemsrfvtg
    etlhvdgglhlpgynsrpagikprey
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jy1D (D:)
    mahhhhhhmglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeire
    mggrslfvktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtl
    ttslwatwwamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaas
    ewgrfnitvnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffas
    emsrfvtgetlhvdgglhlpgynsrpagikprey
    

    Sequence, based on observed residues (ATOM records):
    >5jy1D (D:)
    mglleqrvalvtgagggigrgvarsfgnegaaviiaeinestgrqveqeiremggrslfv
    ktdvtskasieaavrsaveqfgsldilvnnafvptpnvlleektdemleqtlttslwatw
    wamraafvpmrerrwgrivnfysidtetgawlhgdyntakagivgltrsaasewgrfnit
    vnaiaptamgatffelaaknpefaersaaarplgrsgdpeqdigpaavffasemsrfvtg
    etlhvdgglhlpgynsrpagikprey