PDB entry 5jxx

View 5jxx on RCSB PDB site
Description: Crystal structure of UDP-N-acetylglucosamine O-acyltransferase (LpxA) from Moraxella catarrhalis RH4.
Class: transferase
Keywords: UDP-N-acetylglucosamine O-acyltransferase, LpxA, acyltransferase, TRANSFERASE
Deposited on 2016-05-13, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Moraxella catarrhalis (strain BBH18) [TaxId:1236608]
    Gene: lpxA, MCR_0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jxxa_
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Moraxella catarrhalis (strain BBH18) [TaxId:1236608]
    Gene: lpxA, MCR_0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jxxb_
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Moraxella catarrhalis (strain BBH18) [TaxId:1236608]
    Gene: lpxA, MCR_0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jxxc_
  • Chain 'D':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Moraxella catarrhalis (strain BBH18) [TaxId:1236608]
    Gene: lpxA, MCR_0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jxxd_
  • Chain 'E':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Moraxella catarrhalis (strain BBH18) [TaxId:1236608]
    Gene: lpxA, MCR_0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jxxe_
  • Chain 'F':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Moraxella catarrhalis (strain BBH18) [TaxId:1236608]
    Gene: lpxA, MCR_0549
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jxxf_
  • Heterogens: GOL, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jxxA (A:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jxxB (B:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxxB (B:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jxxC (C:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglvr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jxxD (D:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jxxE (E:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxxE (E:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jxxF (F:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxxF (F:)
    mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
    asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
    dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
    masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
    iqllidsinnskrglv