PDB entry 5jxt

View 5jxt on RCSB PDB site
Description: crystal structure of mtiswi bound with histone h4 tail
Deposited on 2016-05-13, released 2016-12-07
The last revision was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: histone h4
    Species: Saitoella complicata NRRL Y-17804, synthetic [TaxId:698492]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jxtA (A:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtA (A:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyds
    dwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqv
    aakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelna
    ryeklgiddlqkftsesayewngedfa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jxtB (B:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtB (B:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyds
    dwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqv
    aakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelna
    ryeklgiddlqkftsesayewngedfaa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jxtC (C:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtC (C:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaesktrllnivmqlrkccnhpylf
    egaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycvfrg
    ykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsdwnp
    qadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqvaaka
    aankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelnaryek
    lgiddlqkftsesayewngedfaa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jxtD (D:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtD (D:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyds
    dwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqv
    aakaaankdellsmiqhgaekvfqddddidailqagetrtkelnaryeklgi
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jxtE (E:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtE (E:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyds
    dwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqv
    aakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelna
    ryeklgiddlqkf
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jxtF (F:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtF (F:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttrginlttadivilydsdwnp
    qadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqvaaka
    aankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelnaryek
    lgiddlqkftsesayewngedfaa
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5jxtG (G:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtG (G:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyds
    dwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqv
    aakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelna
    ryeklgid
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5jxtH (H:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtH (H:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycvfrg
    ykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsdwnp
    qadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqvaaka
    aankdellsmiqhgaekvfqtkgafgtmaekgsqddddidailqagetrtkelnaryekl
    giddlqkftsesayewngedf
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5jxtI (I:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtI (I:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycv
    frgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsd
    wnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqva
    akaaankdellsmiqhgaekvfqtkgafgtmdddidailqagetrtkelnaryeklgidd
    l
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5jxtJ (J:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtJ (J:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycv
    frgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsd
    wnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqva
    aaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelnarye
    klgiddlqkftsesaye
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5jxtK (K:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtK (K:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycv
    frgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsd
    wnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqva
    akaaankdellsmiqhgaekvfqtkgafgtmaeqlddddidailqagetrtkelnaryek
    lgiddl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5jxtL (L:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtL (L:)
    ksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnh
    pylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledyc
    vfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyds
    dwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqv
    aakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelna
    ryeklgiddlq
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5jxtM (M:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtM (M:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycv
    frgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsd
    wnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqva
    akaaankdellsmiqhgaekvfqtkgafgtmaekgslddddidailqagetrtkelnary
    eklgiddlqkftsesayewngedf
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5jxtN (N:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtN (N:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycv
    frgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsd
    wnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqva
    akaaankdellsmiqhgaekvfqtkgafgtmaeddddidailqagetrtkelnaryeklg
    iddlqkftsesayewnged
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5jxtO (O:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtO (O:)
    sllpkkeinvyigmsemqvkwyqkilekdidavnggkresktrllnivmqlrkccnhpyl
    fegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycvfr
    gykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsdwn
    pqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqvaak
    aaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkelnarye
    klgiddlqkftsesayewnged
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5jxtP (P:)
    eksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccn
    hpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledy
    cvfrgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilyd
    sdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraq
    vaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidailqagetrtkeln
    aryeklgiddlqkftsesayewngedfaarkkdiginwinpakrerkeq
    

    Sequence, based on observed residues (ATOM records):
    >5jxtP (P:)
    sllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrllnivmqlrkccnhp
    ylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsqmsrlldiledycv
    frgykycridgstahedriaaideynkpgsdkfifllttragglginlttadivilydsd
    wnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrldqlviqqgraqva
    akankdellsmiqhgaekvfqtkgafgtmaddddidailqagetrtkelnaryeklgidd
    lqkftsesayewnged
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5jxtQ (Q:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtQ (Q:)
    gakrh
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5jxtR (R:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtR (R:)
    gakrh
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >5jxtS (S:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtS (S:)
    gakrh
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >5jxtT (T:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtT (T:)
    gakrh
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >5jxtU (U:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtU (U:)
    gakrh
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >5jxtV (V:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtV (V:)
    gakrh
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >5jxtW (W:)
    sgrgkggkglgkggakrhrki
    

    Sequence, based on observed residues (ATOM records):
    >5jxtW (W:)
    akrh