PDB entry 5jxs

View 5jxs on RCSB PDB site
Description: mutant gc216/7aa of 3d polymerase from foot-and-mouth disease virus
Deposited on 2016-05-13, released 2016-06-01
The last revision was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA dependent RNA polymerase
    Species: Foot-and-mouth disease virus [TaxId:12110]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03311 (0-469)
      • engineered mutation (215-216)
      • expression tag (470-475)
  • Chain 'B':
    Compound: RNA template
    Species: Foot-and-mouth disease virus, synthetic [TaxId:12110]
  • Chain 'C':
    Compound: RNA primer
    Species: Foot-and-mouth disease virus, synthetic [TaxId:12110]
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jxsA (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavaanpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaaalehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >5jxsA (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavaanpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaaaleh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.