PDB entry 5jxr

View 5jxr on RCSB PDB site
Description: crystal structure of mtiswi
Deposited on 2016-05-13, released 2016-12-07
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Chromatin-remodeling complex ATPase-like protein
    Species: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) [TaxId:573729]
    Gene: MYCTH_2307364
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jxrA (A:)
    hdrlgeskeddtlrrfryllgltdlfrhfietnpnpkireimkeidrqneeearqrkrgg
    rqggatserrrrteaeedaellkdekdggsaetvfresppfiqgtmrdyqiaglnwlisl
    hengisgilademglgktlqtiaflgylrhimgitgphlvtvpkstldnwkrefekwtpe
    vnvlvlqgakeerhqlindrlvdenfdvcitsyemilrekahlkkfaweyiiideahrik
    neesslaqvirmfnsrnrllitgtplqnnlhelwallnfllpdvfgdseafdqwfsgqdr
    dqdtvvqqlhrvlrpfllrrvksdveksllpkkeinvyigmsemqvkwyqkilekdidav
    ngaggkresktrllnivmqlrkccnhpylfegaepgppyttdehliynagkmvvldkllk
    riqkqgsrvlifsqmsrlldiledycvfrgykycridgstahedriaaideynkpgsdkf
    ifllttragglginlttadivilydsdwnpqadlqamdrahrigqtkqvvvyrfvtdnai
    eekvleraaqklrldqlviqqgraqvaakaaankdellsmiqhgaekvfqtkgafgtmae
    kgsqlddddidailqagetrtkelnaryeklgiddlqkftsesayewngedfaarkkdig
    inwinpakrerkeqiysidkyykqtfnaggraaeakpkaprapkqvpvhdyqfypprlre
    lqd
    

    Sequence, based on observed residues (ATOM records):
    >5jxrA (A:)
    skeddtlrrfryllgltdlfrhfietnpnpkireimkeidrqneeearqrkrggrqggat
    serrrrteaeedaellkdekdggsaetvfresppfiqgtmrdyqiaglnwlislhengis
    gilademglgktlqtiaflgylrhimgitgphlvtvpkstldnwkrefekwtpevnvlvl
    qgakeerhqlindrlvdenfdvcitsyemilrekahlkkfaweyiiideaslaqvirmfn
    srnrllitgtplqnnlhelwallnfllpdvfgdseafdqwfsgqdrdqdtvvqqlhrvlr
    pfllrrvksdveksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrll
    nivmqlrkccnhpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsq
    msrlldiledycvfrgykycridgstahedriaaideynkpgsdkfifllttragglgin
    lttadivilydsdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrl
    dqlviqqgraqvaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidail
    qagetrtkelnaryeklgiddlqkf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jxrB (B:)
    hdrlgeskeddtlrrfryllgltdlfrhfietnpnpkireimkeidrqneeearqrkrgg
    rqggatserrrrteaeedaellkdekdggsaetvfresppfiqgtmrdyqiaglnwlisl
    hengisgilademglgktlqtiaflgylrhimgitgphlvtvpkstldnwkrefekwtpe
    vnvlvlqgakeerhqlindrlvdenfdvcitsyemilrekahlkkfaweyiiideahrik
    neesslaqvirmfnsrnrllitgtplqnnlhelwallnfllpdvfgdseafdqwfsgqdr
    dqdtvvqqlhrvlrpfllrrvksdveksllpkkeinvyigmsemqvkwyqkilekdidav
    ngaggkresktrllnivmqlrkccnhpylfegaepgppyttdehliynagkmvvldkllk
    riqkqgsrvlifsqmsrlldiledycvfrgykycridgstahedriaaideynkpgsdkf
    ifllttragglginlttadivilydsdwnpqadlqamdrahrigqtkqvvvyrfvtdnai
    eekvleraaqklrldqlviqqgraqvaakaaankdellsmiqhgaekvfqtkgafgtmae
    kgsqlddddidailqagetrtkelnaryeklgiddlqkftsesayewngedfaarkkdig
    inwinpakrerkeqiysidkyykqtfnaggraaeakpkaprapkqvpvhdyqfypprlre
    lqd
    

    Sequence, based on observed residues (ATOM records):
    >5jxrB (B:)
    skeddtlrrfryllgltdlfrhfietnpnpkireimkeidrqneeearqrkrggrqggat
    serrrrteaeedaellkdekdggsaetvfresppfiqgtmrdyqiaglnwlislhengis
    gilademglgktlqtiaflgylrhimgitgphlvtvpkstldnwkrefekwtpevnvlvl
    qgakeerhqlindrlvdenfdvcitsyemilrekahlkkfaweyiiideaslaqvirmfn
    srnrllitgtplqnnlhelwallnfllpdvfgdseafdqwfsgqdrdqdtvvqqlhrvlr
    pfllrrvksdveksllpkkeinvyigmsemqvkwyqkilekdidavngaggkresktrll
    nivmqlrkccnhpylfegaepgppyttdehliynagkmvvldkllkriqkqgsrvlifsq
    msrlldiledycvfrgykycridgstahedriaaideynkpgsdkfifllttragglgin
    lttadivilydsdwnpqadlqamdrahrigqtkqvvvyrfvtdnaieekvleraaqklrl
    dqlviqqgraqvaakaaankdellsmiqhgaekvfqtkgafgtmaekgsqlddddidail
    qagetrtkelnaryeklgiddlqkf