PDB entry 5jxk

View 5jxk on RCSB PDB site
Description: crystal structure of porphyromonas endodontalis dpp11
Deposited on 2016-05-13, released 2017-06-14
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Porphyromonas endodontalis (strain ATCC 35406 / BCRC 14492 / JCM 8526 / HG 370) [TaxId:553175]
    Gene: dpp11, PeDPP11
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8WQK8 (1-696)
      • initiating methionine (0)
      • engineered mutation (631)
      • expression tag (697-698)
  • Chain 'B':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Porphyromonas endodontalis (strain ATCC 35406 / BCRC 14492 / JCM 8526 / HG 370) [TaxId:553175]
    Gene: dpp11, PeDPP11
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8WQK8 (1-End)
      • engineered mutation (631)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jxkA (A:)
    mdggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqgll
    ltnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkele
    rikkpsgleflsprylsslapeivgkkaasrpgyryeikafyggnryymftkkvfrdvrl
    vaappssigkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvna
    qgvkegdfalimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkin
    imyaakyassqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavrais
    kaiegrqdlrmrqryllegilmgiemsnapaadsdiadhwddparreaglqsirkqfeaf
    fnkdyspevekdqlaialltryaeripaekqpisiregiaeygsakayvemifdksiyas
    rerfeefmknpdrdrllrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldm
    kgqpnlapdanltlrftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklka
    lyeaknygryansdgsmpvnfcatthttggnagspvmnargeliglnfdrnwegvggdie
    ylpnyqrsiildiryllfiidkfagcqrlideiqpqfhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jxkA (A:)
    mdggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqgll
    ltnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkele
    rikkpsgleflsprylsslapeivgkkpgyryeikafyggnryymftkkvfrdvrlvaap
    pssigkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvnaqgvk
    egdfalimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkinimya
    akyassqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavraiskaie
    grqdlrmrqryllegilmgiemsnapaadsdiadhwddparreaglqsirkqfeaffnkd
    yspevekdqlaialltryaeripaekqpisiregiaeygsakayvemifdksiyasrerf
    eefmknpdrdrllrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldmkgqp
    nlapdanltlrftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklkalyea
    knygryansdgsmpvnfcatthttggnagspvmnargeliglnfdrnwegvggdieylpn
    yqrsiildiryllfiidkfagcqrlideiqpqfhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jxkB (B:)
    mdggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqgll
    ltnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkele
    rikkpsgleflsprylsslapeivgkkaasrpgyryeikafyggnryymftkkvfrdvrl
    vaappssigkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvna
    qgvkegdfalimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkin
    imyaakyassqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavrais
    kaiegrqdlrmrqryllegilmgiemsnapaadsdiadhwddparreaglqsirkqfeaf
    fnkdyspevekdqlaialltryaeripaekqpisiregiaeygsakayvemifdksiyas
    rerfeefmknpdrdrllrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldm
    kgqpnlapdanltlrftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklka
    lyeaknygryansdgsmpvnfcatthttggnagspvmnargeliglnfdrnwegvggdie
    ylpnyqrsiildiryllfiidkfagcqrlideiqpqfhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jxkB (B:)
    dggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqglll
    tnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkeler
    psgleflsprylsslapeivasrpgyryeikafyggnryymftkkvfrdvrlvaappssi
    gkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvnaqgvkegdf
    alimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkinimyaakya
    ssqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavraiskaiegrqd
    lrmrqryllegilmgiemsnapaadsdiarreaglqsirkqfeaffnkdyspevekdqla
    ialltryaeripaekqpisiregiaeygsakayvemifdksiyasrerfeefmknpdrdr
    llrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldmkgqpnlapdanltlr
    ftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklkalyeaknygryansdg
    smpvnfcatthttggnagspvmnargeliglnfdrnwegvggdieylpnyqrsiildiry
    llfiidkfagcqrlideiqpq