PDB entry 5jxi

View 5jxi on RCSB PDB site
Description: Structure of the unliganded form of the proprotein convertase furin in presence of EDTA.
Class: hydrolase
Keywords: protease, apo-structure, proteolysis, hydrolase
Deposited on 2016-05-13, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FURIN, FUR, PACE, PCSK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09958 (Start-466)
      • expression tag (467-472)
    Domains in SCOPe 2.07: d5jxia1, d5jxia2, d5jxia3
  • Heterogens: CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jxiA (A:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxiA (A:)
    vyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ndwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevr
    ktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgf
    ndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvp