PDB entry 5jxf

View 5jxf on RCSB PDB site
Description: crystal structure of flavobacterium psychrophilum dpp11 in complex with dipeptide arg-asp
Deposited on 2016-05-13, released 2017-06-14
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Flavobacterium psychrophilum [TaxId:96345]
    Gene: dpp11, FP0382
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6GWM2 (35-End)
      • expression tag (33-34)
      • conflict (150)
      • conflict (459)
  • Chain 'B':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Flavobacterium psychrophilum [TaxId:96345]
    Gene: dpp11, FP0382
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6GWM2 (35-End)
      • conflict (150)
      • conflict (459)
  • Chain 'C':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Flavobacterium psychrophilum [TaxId:96345]
    Gene: dpp11, FP0382
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6GWM2 (35-End)
      • conflict (150)
      • conflict (459)
  • Chain 'D':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Flavobacterium psychrophilum [TaxId:96345]
    Gene: dpp11, FP0382
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6GWM2 (35-End)
      • expression tag (33-34)
      • conflict (150)
      • conflict (459)
  • Heterogens: ARG, ASP, CL, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jxfA (A:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdptlqqggmwipsllsgmnetemknlgmk
    isaddiysvnhsslkdavphfnggctsevispkgliltnhhcgfdaiqnhssvdhdyltn
    gfwamkmedelpnenlvvtfivsindvtaqildgvasitsetekqnkiqenitkvtasfa
    keawqenkvrtffegnqyilfvtevfkdvrlvgappsligkfgsdtdnwvwprhtgdfsm
    frvyanknnhpaayskdnvpyipkhflpvsldgvqeddftmvmgypgktqeylpsfavaq
    ivnetnpakieireaalkvqdgfmrkdnaikiqyaskyagvanywkkwigesqglkksna
    iglkqnfekdfqqkviaagkqneygnlladfqkyyteitpyavsrdyfnevvvkntells
    lgyklyqleqvfitkgeqafndrkenliksqadffkdfnstvdekvfeqlvalyatkapk
    eflpisllnveykkfapsiysksklvdyanfkallsgdakavlkkisldkgyafvkslad
    nyskniaprydeinlkinalqriymkaqlelypnsrifpdanstlrvtygkvkgyspkda
    iyynpttyldgaiekyipgdyefdvpkklidlynnkdygqygengklpvcfigtnhttgg
    nsgspavdaqgnliglnfdrvwegtmsdihydpsicrnvmvdmryvlfivdkfagakhli
    nemklvhpkkk
    

    Sequence, based on observed residues (ATOM records):
    >5jxfA (A:)
    tlqqggmwipsllsgmnetemknlgmkisaddiysvnhsslkdavphfnggctsevispk
    gliltnhhcgfdaiqnhssvdhdyltngfwamkmedelpnenlvvtfivsindvtaqild
    gvasitsetekqnkiqenitkvtasfakeawqenkvrtffegnqyilfvtevfkdvrlvg
    appsligkfgsdtdnwvwprhtgdfsmfrvyanknnhpaayskdnvpyipkhflpvsldg
    vqeddftmvmgypgktqeylpsfavaqivnetnpakieireaalkvqdgfmrkdnaikiq
    yaskyagvanywkkwigesqglkksnaiglkqnfekdfqqkviaagkqneygnlladfqk
    yyteitpyavsrdyfnevvvkntellslgyklyqleqvfitkgeqafndrkenliksqad
    ffkdfnstvdekvfeqlvalyatkapkeflpisveykkfapsiysksklvdyanfkalls
    gdakavlkkisldkgyafvksladnyskniaprydeinlkinalqriymkaqlelypnsr
    ifpdanstlrvtygkvkgyspkdaiyynpttyldgaiekyipgdyefdvpkklidlynnk
    dygqygengklpvcfigtnhttggnsgspavdaqgnliglnfdrvwegtmsdihydpsic
    rnvmvdmryvlfivdkfagakhlinemklvhpkk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jxfB (B:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdptlqqggmwipsllsgmnetemknlgmk
    isaddiysvnhsslkdavphfnggctsevispkgliltnhhcgfdaiqnhssvdhdyltn
    gfwamkmedelpnenlvvtfivsindvtaqildgvasitsetekqnkiqenitkvtasfa
    keawqenkvrtffegnqyilfvtevfkdvrlvgappsligkfgsdtdnwvwprhtgdfsm
    frvyanknnhpaayskdnvpyipkhflpvsldgvqeddftmvmgypgktqeylpsfavaq
    ivnetnpakieireaalkvqdgfmrkdnaikiqyaskyagvanywkkwigesqglkksna
    iglkqnfekdfqqkviaagkqneygnlladfqkyyteitpyavsrdyfnevvvkntells
    lgyklyqleqvfitkgeqafndrkenliksqadffkdfnstvdekvfeqlvalyatkapk
    eflpisllnveykkfapsiysksklvdyanfkallsgdakavlkkisldkgyafvkslad
    nyskniaprydeinlkinalqriymkaqlelypnsrifpdanstlrvtygkvkgyspkda
    iyynpttyldgaiekyipgdyefdvpkklidlynnkdygqygengklpvcfigtnhttgg
    nsgspavdaqgnliglnfdrvwegtmsdihydpsicrnvmvdmryvlfivdkfagakhli
    nemklvhpkkk
    

    Sequence, based on observed residues (ATOM records):
    >5jxfB (B:)
    qqggmwipsllsgmnetemknlgmkisaddiysvnhsslkdavphfnggctsevispkgl
    iltnhhcgfdaiqnhssvdhdyltngfwamkmedelpnenlvvtfivsindvtaqildgv
    asitsetekqnkiqenitkvtasfakeawqenkvrtffegnqyilfvtevfkdvrlvgap
    psligkfgsdtdnwvwprhtgdfsmfrvyanknnhpaayskdnvpyipkhflpvsldgvq
    eddftmvmgypgktqeylpsfavaqivnetnpakieireaalkvqdgfmrkdnaikiqya
    skyagvanywkkwigesqglkksnaiglkqnfekdfqqkviaagkqneygnlladfqkyy
    teitpyavsrdyfnevvvkntellslgyklyqleqvfitkgeqafndrkenliksqadff
    kdfnstvdekvfeqlvalyatkapkeflplnveykkfapsiysksklvdyanfkallsgd
    akavlkkisldkgyafvksladnyskniaprydeinlkinalqriymkaqlelypnsrif
    pdanstlrvtygkvkgyspkdaiyynpttyldgaiekyipgdyefdvpkklidlynnkdy
    gqygengklpvcfigtnhttggnsgspavdaqgnliglnfdrvwegtmsdihydpsicrn
    vmvdmryvlfivdkfagakhlinemklvhpkk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jxfC (C:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdptlqqggmwipsllsgmnetemknlgmk
    isaddiysvnhsslkdavphfnggctsevispkgliltnhhcgfdaiqnhssvdhdyltn
    gfwamkmedelpnenlvvtfivsindvtaqildgvasitsetekqnkiqenitkvtasfa
    keawqenkvrtffegnqyilfvtevfkdvrlvgappsligkfgsdtdnwvwprhtgdfsm
    frvyanknnhpaayskdnvpyipkhflpvsldgvqeddftmvmgypgktqeylpsfavaq
    ivnetnpakieireaalkvqdgfmrkdnaikiqyaskyagvanywkkwigesqglkksna
    iglkqnfekdfqqkviaagkqneygnlladfqkyyteitpyavsrdyfnevvvkntells
    lgyklyqleqvfitkgeqafndrkenliksqadffkdfnstvdekvfeqlvalyatkapk
    eflpisllnveykkfapsiysksklvdyanfkallsgdakavlkkisldkgyafvkslad
    nyskniaprydeinlkinalqriymkaqlelypnsrifpdanstlrvtygkvkgyspkda
    iyynpttyldgaiekyipgdyefdvpkklidlynnkdygqygengklpvcfigtnhttgg
    nsgspavdaqgnliglnfdrvwegtmsdihydpsicrnvmvdmryvlfivdkfagakhli
    nemklvhpkkk
    

    Sequence, based on observed residues (ATOM records):
    >5jxfC (C:)
    qqggmwipsllsgmnetemknlgmkisaddiysvnhsslkdavphfnggctsevispkgl
    iltnhhcgfdaiqnhssvdhdyltngfwamkmedelpnenlvvtfivsindvtaqildgv
    astekqnkiqenitkvtasfakeawqenkvrtffegnqyilfvtevfkdvrlvgappsli
    gkfgsdtdnwvwprhtgdfsmfrvyanknnhpaayskdnvpyipkhflpvsldgvqeddf
    tmvmgypgktqeylpsfavaqivnetnpakieireaalkvqdgfmrkdnaikiqyaskya
    gvanywkkwigesqglkksnaiglkqnfekdfqqkviaagkqneygnlladfqkyyteit
    pyavsrdyfnevvvkntellslgyklyqleqvfqafndrkenliksqadffkdfnstvde
    kvfeqlvalyatkapkeflpllnveykkfapsiysksklvdyanfkallsgkavlkkisl
    dkgyafvksladnyskniaprydeinlkinalqriymkaqlelypnsrifpdanstlrvt
    ygkvkgyspkdaiyynpttyldgaiekyipgdyefdvpkklidlynnkdygqygengklp
    vcfigtnhttggnsgspavdaqgnliglnfdrvwegtmsdihydpsicrnvmvdmryvlf
    ivdkfagakhlinemklvhpkk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jxfD (D:)
    mggshhhhhhgmasmtggqqmgrdlyddddkdptlqqggmwipsllsgmnetemknlgmk
    isaddiysvnhsslkdavphfnggctsevispkgliltnhhcgfdaiqnhssvdhdyltn
    gfwamkmedelpnenlvvtfivsindvtaqildgvasitsetekqnkiqenitkvtasfa
    keawqenkvrtffegnqyilfvtevfkdvrlvgappsligkfgsdtdnwvwprhtgdfsm
    frvyanknnhpaayskdnvpyipkhflpvsldgvqeddftmvmgypgktqeylpsfavaq
    ivnetnpakieireaalkvqdgfmrkdnaikiqyaskyagvanywkkwigesqglkksna
    iglkqnfekdfqqkviaagkqneygnlladfqkyyteitpyavsrdyfnevvvkntells
    lgyklyqleqvfitkgeqafndrkenliksqadffkdfnstvdekvfeqlvalyatkapk
    eflpisllnveykkfapsiysksklvdyanfkallsgdakavlkkisldkgyafvkslad
    nyskniaprydeinlkinalqriymkaqlelypnsrifpdanstlrvtygkvkgyspkda
    iyynpttyldgaiekyipgdyefdvpkklidlynnkdygqygengklpvcfigtnhttgg
    nsgspavdaqgnliglnfdrvwegtmsdihydpsicrnvmvdmryvlfivdkfagakhli
    nemklvhpkkk
    

    Sequence, based on observed residues (ATOM records):
    >5jxfD (D:)
    tlqqggmwipsllsgmnetemknlgmkisaddiysvnhsslkdavphfnggctsevispk
    gliltnhhcgfdaiqnhssvdhdyltngfwamkmedelpnenlvvtfivsindvtaqild
    gvastekqnkiqenitkvtasfakeawqenkvrtffegnqyilfvtevfkdvrlvgapps
    ligkfgsdtdnwvwprhtgdfsmfrvyanknnhpaayskdnvpyipkhflpvsldgvqed
    dftmvmgypgktqeylpsfavaqivnetnpakieireaalkvqdgfmrkdnaikiqyask
    yagvanywkkwigesqglkksnaiglkqnfekdfqqkviaagkqneygnlladfqkyyte
    itpyavsrdyfnevvvkntellslgyklyqleqvfqafndrkenliksqadffkdfnstv
    dekvfeqlvalyatkapkeflpisleykkfapsiysksklvdyanfkallsgdakavlkk
    isldkgyafvksladnyskniaprydeinlkinalqriymkaqlelypnsrifpdanstl
    rvtygkvkgyspkdaiyynpttyldgaiekyipgdyefdvpkklidlynnkdygqygeng
    klpvcfigtnhttggnsgspavdaqgnliglnfdrvwegtmsdihydpsicrnvmvdmry
    vlfivdkfagakhlinemklvhpkk