PDB entry 5jxe

View 5jxe on RCSB PDB site
Description: Human PD-1 ectodomain complexed with Pembrolizumab Fab
Class: immune system
Keywords: human PD-1 Pembrolizumab Fab, IMMUNE SYSTEM
Deposited on 2016-05-13, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Pdcd1, Pd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15116 (Start-113)
      • engineered mutation (60)
    Domains in SCOPe 2.07: d5jxea_
  • Chain 'B':
    Compound: Programmed cell death protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Pdcd1, Pd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15116 (0-End)
      • engineered mutation (60)
    Domains in SCOPe 2.07: d5jxeb_
  • Chain 'C':
    Compound: Pembrolizumab Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JXE (0-End)
    Domains in SCOPe 2.07: d5jxec1, d5jxec2
  • Chain 'D':
    Compound: Pembrolizumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JXE (0-217)
  • Chain 'F':
    Compound: Pembrolizumab Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JXE (0-End)
    Domains in SCOPe 2.07: d5jxef1, d5jxef2
  • Chain 'G':
    Compound: Pembrolizumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JXE (0-217)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jxeA (A:)
    npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
    srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxeA (A:)
    pptfspallvvtegdnatftcvlnwyrmspsnqtdklaafpedrsqpgqdsrfrvtqlpn
    grdfhmsvvrarrndsgtylcgaiskeslraelrvte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jxeB (B:)
    npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
    srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxeB (B:)
    npptfspallvvtegdnatftcsfssfvlnwyrmqtdklaafpedrsqpgqdsrfrvtql
    pngrdfhmsvvrarrndsgtylcgaislaqikeslraelrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jxeC (C:)
    eivltqspatlslspgeratlscraskgvstsgysylhwyqqkpgqaprlliylasyles
    gvparfsgsgsgtdftltisslepedfavyycqhsrdlpltfgggtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxeC (C:)
    eivltqspatlslspgeratlscraskgvstsgysylhwyqqkpgqaprlliylasyles
    gvparfsgsgsgtdftltisslepedfavyycqhsrdlpltfgggtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jxeF (F:)
    eivltqspatlslspgeratlscraskgvstsgysylhwyqqkpgqaprlliylasyles
    gvparfsgsgsgtdftltisslepedfavyycqhsrdlpltfgggtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jxeF (F:)
    eivltqspatlslspgeratlscraskgvstsgysylhwyqqkpgqaprlliylasyles
    gvparfsgsgsgtdftltisslepedfavyycqhsrdlpltfgggtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'G':
    No sequence available.