PDB entry 5jxc

View 5jxc on RCSB PDB site
Description: syngap coiled-coil trimer
Deposited on 2016-05-13, released 2016-09-28
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras/Rap GTPase-activating protein SynGAP
    Species: Mus musculus [TaxId:10090]
    Gene: Syngap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras/Rap GTPase-activating protein SynGAP
    Species: Mus musculus [TaxId:10090]
    Gene: Syngap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ras/Rap GTPase-activating protein SynGAP
    Species: Mus musculus [TaxId:10090]
    Gene: Syngap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ras/Rap GTPase-activating protein SynGAP
    Species: Mus musculus [TaxId:10090]
    Gene: Syngap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ras/Rap GTPase-activating protein SynGAP
    Species: Mus musculus [TaxId:10090]
    Gene: Syngap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras/Rap GTPase-activating protein SynGAP
    Species: Mus musculus [TaxId:10090]
    Gene: Syngap1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jxcA (A:)
    gpgsdesrldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqse
    krlrqqqvekdsqiksiigrlmlveeelrrdh
    

    Sequence, based on observed residues (ATOM records):
    >5jxcA (A:)
    srldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqsekrlrqq
    qvekdsqiksiigrlmlveeelrrdh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jxcB (B:)
    gpgsdesrldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqse
    krlrqqqvekdsqiksiigrlmlveeelrrdh
    

    Sequence, based on observed residues (ATOM records):
    >5jxcB (B:)
    yeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqsekrlrqqqvekds
    qiksiigrlmlveeelrr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jxcC (C:)
    gpgsdesrldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqse
    krlrqqqvekdsqiksiigrlmlveeelrrdh
    

    Sequence, based on observed residues (ATOM records):
    >5jxcC (C:)
    eyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqsekrlrqqqvekd
    sqiksiigrlmlveeelr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jxcD (D:)
    gpgsdesrldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqse
    krlrqqqvekdsqiksiigrlmlveeelrrdh
    

    Sequence, based on observed residues (ATOM records):
    >5jxcD (D:)
    eyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqsekrlrqqqvekd
    sqiksiigrlmlveeelr
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jxcE (E:)
    gpgsdesrldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqse
    krlrqqqvekdsqiksiigrlmlveeelrrdh
    

    Sequence, based on observed residues (ATOM records):
    >5jxcE (E:)
    srldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqsekrlrqq
    qvekdsqiksiigrlmlveeelrr
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5jxcF (F:)
    gpgsdesrldreyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqse
    krlrqqqvekdsqiksiigrlmlveeelrrdh
    

    Sequence, based on observed residues (ATOM records):
    >5jxcF (F:)
    reyeeeihslkerlhmsnrkleeyerrllsqeeqtskilmqyqarleqsekrlrqqqvek
    dsqiksiigrlmlveeelrr