PDB entry 5jx8

View 5jx8 on RCSB PDB site
Description: new improved structure of d4 in trigonal space group
Deposited on 2016-05-12, released 2017-02-08
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Vaccinia virus (strain Western Reserve) [TaxId:10254]
    Gene: UNG, TS17, VACWR109, D4R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04303 (20-237)
      • expression tag (11-19)
      • see remark 999 (36)
      • see remark 999 (182)
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Vaccinia virus (strain Western Reserve) [TaxId:10254]
    Gene: UNG, TS17, VACWR109, D4R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04303 (20-237)
      • expression tag (17-19)
      • see remark 999 (36)
      • see remark 999 (182)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jx8A (A:)
    mgsshhhhhhssglvprgshmnsvtvshapytityhndwepvmsqlvefynevaswllrd
    etspipdkffiqlkqplrnkrvcvcgidpypkdgtgvpfespnftkksikeiassisrlt
    gvidykgynlniidgvipwnyylscklgetkshaiywdkisklllqhitkhvsvlyclgk
    tdfsniraklespvttivgyhpaardrqfekdrsfeiinvlleldnkapinwaqgfiy
    

    Sequence, based on observed residues (ATOM records):
    >5jx8A (A:)
    sglvprgshmnsvtvshapytityhndwepvmsqlvefynevaswllrdetspipdkffi
    qlkqplrnkrvcvcgidpypkdgtgvpfespnftkksikeiassisrltgvidykgynln
    iidgvipwnyylscklgetkshaiywdkisklllqhitkhvsvlyclgktdfsnirakle
    spvttivgyhpaardrqfekdrsfeiinvlleldnkapinwaqgfiy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jx8B (B:)
    mgsshhhhhhssglvprgshmnsvtvshapytityhndwepvmsqlvefynevaswllrd
    etspipdkffiqlkqplrnkrvcvcgidpypkdgtgvpfespnftkksikeiassisrlt
    gvidykgynlniidgvipwnyylscklgetkshaiywdkisklllqhitkhvsvlyclgk
    tdfsniraklespvttivgyhpaardrqfekdrsfeiinvlleldnkapinwaqgfiy
    

    Sequence, based on observed residues (ATOM records):
    >5jx8B (B:)
    gshmnsvtvshapytityhndwepvmsqlvefynevaswllrdetspipdkffiqlkqpl
    rnkrvcvcgidpypkdgtgvpfespnftkksikeiassisrltgvidykgynlniidgvi
    pwnyylscklgetkshaiywdkisklllqhitkhvsvlyclgktdfsniraklespvtti
    vgyhpaardrqfekdrsfeiinvlleldnkapinwaqgfiy