PDB entry 5jx7

View 5jx7 on RCSB PDB site
Description: cysteine mutant (c224a) structure of as (iii) s-adenosyl methyltransferase
Deposited on 2016-05-12, released 2017-05-17
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arsenic methyltransferase
    Species: Cyanidioschyzon sp. 5508 [TaxId:610260]
    Gene: arsM
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0JV69 (Start-369)
      • expression tag (370)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jx7A (A:)
    mpcscasgcqksknggstpsirdhvadyygktlqssadlktsacklaaavpeshrkilad
    iadevlekfygcgstlpadgslegatvldlgcgtgrdvylasklvgehgkvigvdmldnq
    levarkyveyhaekffgspsrsnvrflkgfienlataepegvpdssvdivisncvcnlst
    nklalfkeihrvlrdggelyfsdvyadrrlseaaqqdpilygeclggalyledfrrlvae
    agfrdvrlvsvgpvdvsdpqlrklvpdvqfysctfrcfkvatleatredygqsatylggi
    geefkldrfftfprekpvrvdrntaeiirhsrlhqwfsvsaeqqhmglfkandsyallha
    plsmqveqlvshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jx7A (A:)
    avpeshrkiladiadevlekfygcgstlpadgslegatvldlgcgtgrdvylasklvgeh
    gkvigvdmldnqlevarkyveyhaekffgspsrsnvrflkgfienlataepegvpdssvd
    ivisncvcnlstnklalfkeihrvlrdggelyfsdvyadrrlseaaqqdpilygeclgga
    lyledfrrlvaeagfrdvrlvsvgpvdvsdpqlrklvpdvqfysctfrcfkvatleatre
    dygqsatylggigeefkldrfftfprekpvrvdrntaeiirhsrlhqwfsvsaeqqhmgl
    fkandsyallhaplsmqveqlvs