PDB entry 5jx5

View 5jx5 on RCSB PDB site
Description: GH6 Orpinomyces sp. Y102 enzyme
Class: hydrolase
Keywords: Orpinomyces sp., GH6, Cbh7, endoglucanases, exoglucanases, HYDROLASE
Deposited on 2016-05-12, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucanase
    Species: Orpinomyces sp. Y102 [TaxId:884017]
    Gene: cbhC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jx5a_
  • Chain 'B':
    Compound: glucanase
    Species: Orpinomyces sp. Y102 [TaxId:884017]
    Gene: cbhC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jx5b_
  • Chain 'C':
    Compound: glucanase
    Species: Orpinomyces sp. Y102 [TaxId:884017]
    Gene: cbhC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jx5c_
  • Chain 'D':
    Compound: glucanase
    Species: Orpinomyces sp. Y102 [TaxId:884017]
    Gene: cbhC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jx5d_
  • Heterogens: PO4, GOL, EDO, NH4, MPD, PEG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jx5A (A:)
    tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
    neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
    dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
    iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
    pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
    paagswfhdyfvmllenanppf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jx5B (B:)
    tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
    neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
    dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
    iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
    pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
    paagswfhdyfvmllenanppf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jx5C (C:)
    tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
    neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
    dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
    iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
    pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
    paagswfhdyfvmllenanppf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jx5D (D:)
    tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
    neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
    dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
    iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
    pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
    paagswfhdyfvmllenanppf