PDB entry 5jx1

View 5jx1 on RCSB PDB site
Description: The neck-linker and alpha 7 helix of Mus musculus KIF3A fused to EB1
Class: motor protein
Keywords: kinesin, coiled-coil, MOTOR PROTEIN
Deposited on 2016-05-12, released 2016-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera protein of Kinesin-like protein KIF3A and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jx1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5jx1A (A:)
lsnedpkdallrqfqkeieelkkkleelekerdfyfgklrnielicqenegendpvlqri
vdilyatdegfvipd

    Sequence, based on observed residues (ATOM records): (download) 
    >5jx1A (A:)
dpkdallrqfqkeieelkkkleelekerdfyfgklrnielicqdpvlqrivdilyatdeg
fvip