PDB entry 5jwz

View 5jwz on RCSB PDB site
Description: Structure of a Putative Xyloglucanase from the Cellulolytic Bacteria Streptomyces sp. SirexAA-E
Class: hydrolase
Keywords: Hydrolase, Xyloglucanase, Xyloglucan, biomass, Streptomyces sp. SirexAA-E, GH74, Glycoside Hydrolase
Deposited on 2016-05-12, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose-binding family II
    Species: Streptomyces sp. (strain SirexAA-E / ActE) [TaxId:862751]
    Gene: SACTE_0562
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jwza1, d5jwza2
  • Chain 'B':
    Compound: Cellulose-binding family II
    Species: Streptomyces sp. (strain SirexAA-E / ActE) [TaxId:862751]
    Gene: SACTE_0562
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jwzb1, d5jwzb2
  • Heterogens: EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jwzA (A:)
    dtytwknaridgggfvpgivfnrseknlayartdiggayrwdqsgkqwkplldwvdwdrw
    gwtgvvslasdtvdpdnvyaavgtytnswdptdgavlrssdrgaswkaatlpfklggnmp
    grgmgerlavdpnknsvlylgapsgnglwrstdagvswsevtafpnpgnyaqdpsdtsgy
    gndnqgivwvtfdersgsagsatqdiyvgvadkentvyrstdggatwsripgqptgylah
    kgvldsatghlyltlsdtggpydggkgriwrydtasgawqdvspvaeadayygfsglsvd
    rqkpgtlmataysswwpdtqifrstdsgatwtqawdytgypnrsnrytldvssvpwlswg
    aspappetapklgwmtealeidpfdsdrmmygtgatvygtedltswdsggtfritpmvkg
    ieetavndlasppsgapllsalgdiggfrhtdldavpdlmytspnldsttsldfaesspg
    tvvrvgnsdaaphigfstdnganwfqgsepsgvtgggtvaaaadgsgfvwspegagvhht
    tgfgtswtastgipagatvesdrknpekfygfeagtfyvstdggatftaeatglpaegnv
    rfqalpgtegdiwlaggsdtgayglwrstdsgatftksagveqadsvgfgkaapgasyrt
    vfvsakiggvrgifrstdagaswtrinddahqwgwtgaaitgdprvygrvyvstngrgiq
    vget
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jwzB (B:)
    dtytwknaridgggfvpgivfnrseknlayartdiggayrwdqsgkqwkplldwvdwdrw
    gwtgvvslasdtvdpdnvyaavgtytnswdptdgavlrssdrgaswkaatlpfklggnmp
    grgmgerlavdpnknsvlylgapsgnglwrstdagvswsevtafpnpgnyaqdpsdtsgy
    gndnqgivwvtfdersgsagsatqdiyvgvadkentvyrstdggatwsripgqptgylah
    kgvldsatghlyltlsdtggpydggkgriwrydtasgawqdvspvaeadayygfsglsvd
    rqkpgtlmataysswwpdtqifrstdsgatwtqawdytgypnrsnrytldvssvpwlswg
    aspappetapklgwmtealeidpfdsdrmmygtgatvygtedltswdsggtfritpmvkg
    ieetavndlasppsgapllsalgdiggfrhtdldavpdlmytspnldsttsldfaesspg
    tvvrvgnsdaaphigfstdnganwfqgsepsgvtgggtvaaaadgsgfvwspegagvhht
    tgfgtswtastgipagatvesdrknpekfygfeagtfyvstdggatftaeatglpaegnv
    rfqalpgtegdiwlaggsdtgayglwrstdsgatftksagveqadsvgfgkaapgasyrt
    vfvsakiggvrgifrstdagaswtrinddahqwgwtgaaitgdprvygrvyvstngrgiq
    vget
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jwzB (B:)
    tytwknaridgggfvpgivfnrseknlayartdiggayrwdqsgkqwkplldwvdwdrwg
    wtgvvslasdtvdpdnvyaavgtytnswdptdgavlrssdrgaswkaatlpfklggnmpg
    rgmgerlavdpnknsvlylgapsgnglwrstdagvswsevtafpnpgnyaqdpsdtsgyg
    ndnqgivwvtfdersgsagsatqdiyvgvadkentvyrstdggatwsripgqptgylahk
    gvldsatghlyltlsdtggpydggkgriwrydtasgawqdvspvaeadayygfsglsvdr
    qkpgtlmataysswwpdtqifrstdsgatwtqawdytgypnrsnrytldvssvpwlswga
    spappetapklgwmtealeidpfdsdrmmygtgatvygtedltswdsggtfritpmvkgi
    eetavndlasppsgapllsalgdiggfrhtdldavpdlmytspnldsttsldfaesspgt
    vvrvgnsdaaphigfstdnganwfqgsepsgvtgggtvaaaadgsgfvwspegagvhhtt
    gfgtswtastgipagatvesdrknpekfygfeagtfyvstdggatftaeatglpaegnvr
    fqalpgtegdiwlaggsdtgayglwrstdsgatftksagveqadsvgfgkaapgasyrtv
    fvsakiggvrgifrstdagaswtrinddahqwgwtgaaitgdprvygrvyvstngrgiqv
    get