PDB entry 5jwm

View 5jwm on RCSB PDB site
Description: Bivalent BET Bromodomain Inhibition
Class: transcription/transcription inhibitor
Keywords: bivalent-ligand, bromodomain, inhibitor, transcription-transcription inhibitor complex
Deposited on 2016-05-12, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jwma_
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jwmb_
  • Heterogens: 6ON, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jwmA (A:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jwmA (A:)
    vseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksklea
    reyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jwmB (B:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jwmB (B:)
    vseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksklea
    reyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd