PDB entry 5jwg

View 5jwg on RCSB PDB site
Description: crystal structure of porphyromonas endodontalis dpp11 in complex with dipeptide arg-asp
Deposited on 2016-05-12, released 2017-06-14
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Porphyromonas endodontalis [TaxId:28124]
    Gene: dpp11, PeDPP11
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8WQK8 (1-696)
      • initiating methionine (0)
      • engineered mutation (631)
      • expression tag (697-702)
  • Chain 'B':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Porphyromonas endodontalis [TaxId:28124]
    Gene: dpp11, PeDPP11
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8WQK8 (1-696)
      • initiating methionine (0)
      • engineered mutation (631)
      • expression tag (697)
  • Heterogens: ARG, ASP, EDO, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jwgA (A:)
    mdggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqgll
    ltnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkele
    rikkpsgleflsprylsslapeivgkkaasrpgyryeikafyggnryymftkkvfrdvrl
    vaappssigkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvna
    qgvkegdfalimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkin
    imyaakyassqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavrais
    kaiegrqdlrmrqryllegilmgiemsnapaadsdiadhwddparreaglqsirkqfeaf
    fnkdyspevekdqlaialltryaeripaekqpisiregiaeygsakayvemifdksiyas
    rerfeefmknpdrdrllrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldm
    kgqpnlapdanltlrftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklka
    lyeaknygryansdgsmpvnfcatthttggnagspvmnargeliglnfdrnwegvggdie
    ylpnyqrsiildiryllfiidkfagcqrlideiqpqfhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jwgB (B:)
    mdggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqgll
    ltnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkele
    rikkpsgleflsprylsslapeivgkkaasrpgyryeikafyggnryymftkkvfrdvrl
    vaappssigkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvna
    qgvkegdfalimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkin
    imyaakyassqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavrais
    kaiegrqdlrmrqryllegilmgiemsnapaadsdiadhwddparreaglqsirkqfeaf
    fnkdyspevekdqlaialltryaeripaekqpisiregiaeygsakayvemifdksiyas
    rerfeefmknpdrdrllrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldm
    kgqpnlapdanltlrftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklka
    lyeaknygryansdgsmpvnfcatthttggnagspvmnargeliglnfdrnwegvggdie
    ylpnyqrsiildiryllfiidkfagcqrlideiqpqfhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jwgB (B:)
    mdggmwlmqqingqvarmkslgmqleaadiynpngsslkdavvmfdggctgvlvsnqgll
    ltnhhcgydqiqkhssvqhnylkdgfwsyslaeelvnpgleveivdeitdvtaavkkele
    rikkpsgleflsprylsslapeivgkkaasrpgyryeikafyggnryymftkkvfrdvrl
    vaappssigkfgsdtdnwawprhtgdfsifrlyadkngnpaeyskdnvpyrpkrwvkvna
    qgvkegdfalimgypgttykfftadevtewseidnniriemrgilqdvmlremladpkin
    imyaakyassqngykraqganwairrrslreiklaqqqevlawakqkgiatteeavrais
    kaiegrqdlrmrqryllegilmgiemsnapsdiadhwddparreaglqsirkqfeaffnk
    dyspevekdqlaialltryaeripaekqpisiregiaeygsakayvemifdksiyasrer
    feefmknpdrdrllrdpmsrfaasvayehqklakevaafdaplaaaqrsyvasvldmkgq
    pnlapdanltlrftygeikgyqprdvvtygakstlegvmekedpnnweyvvdpklkalye
    aknygryansdgsmpvnfcatthttggnagspvmnargeliglnfdrnwegvggdieylp
    nyqrsiildiryllfiidkfagcqrlideiqpqfh