PDB entry 5jwf

View 5jwf on RCSB PDB site
Description: crystal structure of porphyromonas gingivalis dpp11
Deposited on 2016-05-12, released 2017-06-14
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: dpp11, PGN_0607
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RID1 (1-699)
      • initiating methionine (0)
      • conflict (634)
      • engineered mutation (634)
  • Chain 'B':
    Compound: Asp/Glu-specific dipeptidyl-peptidase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: dpp11, PGN_0607
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2RID1 (Start-699)
      • conflict (634)
      • engineered mutation (634)
  • Heterogens: GOL, PGO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jwfA (A:)
    mdegmwlmqqlgrkyaqmkerglkmkeydlynpngtslkdavvlfdggctgevvsdrglv
    ltnhhcgydmiqahstlehnylengfwamreadelpnkdisvvfidkiedvtdyvkkelk
    aikdpnsmdylspkylqkladkkagknfsaknpglsveikafyggnlylmftkktytdvr
    lvgappssigkfgadtdnwiwprhtgdfsifriyadkngnpapysednvplkpkrffnis
    lggvqendyamimgfpgtthryftasevdewksidndirirmrdirqgvmlremladpqi
    kimysakyaasqnaykraiganwaiktrglrqnkqamqdrliawgakqgtpryeeavhei
    datvakradlrrrywmieegiirgiefarspiptedetkalqgndasarkeaidkirtry
    skfankdysaevdkkvavamlteylkeipyenlplhlrlvkdrfagdvqayvddifarsv
    fgseaqfdafaavpsveklaedpmvlfassvfdeyrklynelrpyddpilraqrtyiagl
    lemdgdqdqfpdanltlrftygqvkgysprdnvyyghqttldgvmekedpdnwefvvdpk
    lkavyerkdfgryadrsgrmpvafcatthttggnagspvmnangeliglnfdrnwegvgg
    diqyladyqrsiivdiryvllvidkvggcqrlldemnivphhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jwfA (A:)
    mdegmwlmqqlgrkyaqmkerglkmkeydlynpngtslkdavvlfdggctgevvsdrglv
    ltnhhcgydmiqahstlehnylengfwamreadelpnkdisvvfidkiedvtdyvkkelk
    aikdpnsmdylspkylqkladkkagknfsaknpglsveikafyggnlylmftkktytdvr
    lvgappssigkfgadtdnwiwprhtgdfsifriyadkngnpapysednvplkpkrffnis
    lggvqendyamimgfpgtthryftasevdewksidndirirmrdirqgvmlremladpqi
    kimysakyaasqnaykraiganwaiktrglrqnkqamqdrliawgakqgtpryeeavhei
    datvakradlrrrywmieegiirgiefarspiptedetkalqgndasarkeaidkirtry
    skfankdysaevdkkvavamlteylkeipyenlplhlrlvkdrfagdvqayvddifarsv
    fgseaqfdafaavpsveklaedpmvlfassvfdeyrklynelrpyddpilraqrtyiagl
    lemdgdqdqfpdanltlrftygqvkgysprdnvyyghqttldgvmekedpdnwefvvdpk
    lkavyerkdfgryadrsgrmpvafcatthttggnagspvmnangeliglnfdrnwegvgg
    diqyladyqrsiivdiryvllvidkvggcqrlldemnivp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jwfB (B:)
    mdegmwlmqqlgrkyaqmkerglkmkeydlynpngtslkdavvlfdggctgevvsdrglv
    ltnhhcgydmiqahstlehnylengfwamreadelpnkdisvvfidkiedvtdyvkkelk
    aikdpnsmdylspkylqkladkkagknfsaknpglsveikafyggnlylmftkktytdvr
    lvgappssigkfgadtdnwiwprhtgdfsifriyadkngnpapysednvplkpkrffnis
    lggvqendyamimgfpgtthryftasevdewksidndirirmrdirqgvmlremladpqi
    kimysakyaasqnaykraiganwaiktrglrqnkqamqdrliawgakqgtpryeeavhei
    datvakradlrrrywmieegiirgiefarspiptedetkalqgndasarkeaidkirtry
    skfankdysaevdkkvavamlteylkeipyenlplhlrlvkdrfagdvqayvddifarsv
    fgseaqfdafaavpsveklaedpmvlfassvfdeyrklynelrpyddpilraqrtyiagl
    lemdgdqdqfpdanltlrftygqvkgysprdnvyyghqttldgvmekedpdnwefvvdpk
    lkavyerkdfgryadrsgrmpvafcatthttggnagspvmnangeliglnfdrnwegvgg
    diqyladyqrsiivdiryvllvidkvggcqrlldemnivphhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5jwfB (B:)
    egmwlmqqlgrkyaqmkerglkmkeydlynpngtslkdavvlfdggctgevvsdrglvlt
    nhhcgydmiqahstlehnylengfwamreadelpnkdisvvfidkiedvtdyvkkelkai
    kdpnsmdylspkylqkladkkagknfsaknpglsveikafyggnlylmftkktytdvrlv
    gappssigkfgadtdnwiwprhtgdfsifriyadkngnpapysednvplkpkrffnislg
    gvqendyamimgfpgtthryftasevdewksidndirirmrdirqgvmlremladpqiki
    mysakyaasqnaykraiganwaiktrglrqnkqamqdrliawgakqgtpryeeavheida
    tvakradlrrrywmieegiirgiefarspiptedetkalqgndasarkeaidkirtrysk
    fankdysaevdkkvavamlteylkeipyenlplhlrlvkdrfagdvqayvddifarsvfg
    seaqfdafaavpsveklaedpmvlfassvfdeyrklynelrpyddpilraqrtyiaglle
    mdgdqdqfpdanltlrftygqvkgysprdnvyyghqttldgvmekedpdnwefvvdpklk
    avyerkdfgryadrsgrmpvafcatthttggnagspvmnangeliglnfdrnwegvggdi
    qyladyqrsiivdiryvllvidkvggcqrlldemnivp