PDB entry 5jvt

View 5jvt on RCSB PDB site
Description: crystal structure of the dna binding domain of transcription factor fli1 in complex with an 11-mer dna gaccggaagtg
Deposited on 2016-05-11, released 2016-09-14
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Friend leukemia integration 1 transcription factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FLI1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*gp*ap*cp*cp*gp*gp*ap*ap*gp*tp*g)-3')
    Species: Endothia gyrosa, synthetic [TaxId:40263]
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*cp*tp*tp*cp*cp*gp*gp*tp*c)-3')
    Species: Endothia gyrosa, synthetic [TaxId:40263]
  • Chain 'D':
    Compound: Friend leukemia integration 1 transcription factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FLI1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA (5'-d(*gp*ap*cp*cp*gp*gp*ap*ap*gp*tp*g)-3')
    Species: Endothia gyrosa, synthetic [TaxId:40263]
  • Chain 'F':
    Compound: DNA (5'-d(*cp*ap*cp*tp*tp*cp*cp*gp*gp*tp*c)-3')
    Species: Endothia gyrosa, synthetic [TaxId:40263]
  • Chain 'G':
    Compound: Friend leukemia integration 1 transcription factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FLI1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA (5'-d(*gp*ap*cp*cp*gp*gp*ap*ap*gp*tp*g)-3')
    Species: Endothia gyrosa, synthetic [TaxId:40263]
  • Chain 'I':
    Compound: DNA (5'-d(*cp*ap*cp*tp*tp*cp*cp*gp*gp*tp*c)-3')
    Species: Endothia gyrosa, synthetic [TaxId:40263]
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jvtA (A:)
    gphmpgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmn
    ydklsralryyydknimtkvhgkryaykfdfhgiaqalqphpte
    

    Sequence, based on observed residues (ATOM records):
    >5jvtA (A:)
    gqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydklsra
    lryyydknimtkvhgkryaykfdfhgiaqalqphpt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jvtD (D:)
    gphmpgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmn
    ydklsralryyydknimtkvhgkryaykfdfhgiaqalqphpte
    

    Sequence, based on observed residues (ATOM records):
    >5jvtD (D:)
    gqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydklsra
    lryyydknimtkvhgkryaykfdfhgiaqalqp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5jvtG (G:)
    gphmpgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmn
    ydklsralryyydknimtkvhgkryaykfdfhgiaqalqphpte
    

    Sequence, based on observed residues (ATOM records):
    >5jvtG (G:)
    gqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydklsra
    lryyydknimtkvhgkryaykfdfhgiaqalqp
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.