PDB entry 5jvp

View 5jvp on RCSB PDB site
Description: The neck-linker and alpha 7 helix of Homo sapiens CENP-E
Class: motor protein
Keywords: kinesin, coiled-coil, MOTOR PROTEIN
Deposited on 2016-05-11, released 2016-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02224 (2-41)
    • expression tag (0-1)
  • Uniprot Q15691 (42-89)
• Chain 'B':
  Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02224 (2-41)
    • expression tag (0-1)
  • Uniprot Q15691 (42-89)
• Chain 'C':
  Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02224 (2-41)
    • expression tag (0-1)
  • Uniprot Q15691 (42-89)
• Chain 'D':
  Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02224 (2-41)
    • expression tag (0-1)
  • Uniprot Q15691 (42-89)
• Chain 'E':
  Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02224 (2-41)
    • expression tag (0-1)
  • Uniprot Q15691 (42-89)
• Chain 'F':
  Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02224 (2-41)
    • expression tag (0-1)
  • Uniprot Q15691 (42-End)
  Domains in SCOPe 2.08: d5jvpf1, d5jvpf2
• Heterogens: CD, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >5jvpF (F:)
  lsnevstdeallkryrkeimdlkkqleevsletraqamekdqlekerdfyfgklrnieli
  cqenegendpvlqrivdilyatdegfvipd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5jvpF (F:)
  lsnevstdeallkryrkeimdlkkqleevsletraqamekdqlekerdfyfgklrnieli
  cqedpvlqrivdilyatdegfvip