PDB entry 5jvp

View 5jvp on RCSB PDB site
Description: The neck-linker and alpha 7 helix of Homo sapiens CENP-E
Class: motor protein
Keywords: kinesin, coiled-coil, MOTOR PROTEIN
Deposited on 2016-05-11, released 2016-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02224 (2-41)
      • expression tag (0-1)
    • Uniprot Q15691 (42-89)
  • Chain 'B':
    Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02224 (2-41)
      • expression tag (0-1)
    • Uniprot Q15691 (42-89)
  • Chain 'C':
    Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02224 (2-41)
      • expression tag (0-1)
    • Uniprot Q15691 (42-89)
  • Chain 'D':
    Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02224 (2-41)
      • expression tag (0-1)
    • Uniprot Q15691 (42-89)
  • Chain 'E':
    Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02224 (2-41)
      • expression tag (0-1)
    • Uniprot Q15691 (42-89)
  • Chain 'F':
    Compound: Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02224 (2-41)
      • expression tag (0-1)
    • Uniprot Q15691 (42-End)
    Domains in SCOPe 2.07: d5jvpf1, d5jvpf2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jvpF (F:)
    lsnevstdeallkryrkeimdlkkqleevsletraqamekdqlekerdfyfgklrnieli
    cqenegendpvlqrivdilyatdegfvipd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jvpF (F:)
    lsnevstdeallkryrkeimdlkkqleevsletraqamekdqlekerdfyfgklrnieli
    cqedpvlqrivdilyatdegfvip