PDB entry 5jvm

View 5jvm on RCSB PDB site
Description: The neck-linker and alpha 7 helix of Mus musculus KIF3C
Class: motor protein
Keywords: kinesin, coiled-coil, MOTOR PROTEIN
Deposited on 2016-05-11, released 2016-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera protein of Kinesin-like protein KIF3C and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35066 (2-30)
      • expression tag (0-1)
    • Uniprot Q15691 (31-81)
    Domains in SCOPe 2.08: d5jvma1, d5jvma2
  • Chain 'B':
    Compound: Chimera protein of Kinesin-like protein KIF3C and Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35066 (2-30)
      • expression tag (0-1)
    • Uniprot Q15691 (31-End)
    Domains in SCOPe 2.08: d5jvmb1, d5jvmb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jvmA (A:)
lsnedpkdtllrefqeeiarlkaqlekkgmlvedlekerdfyfgklrnielicqenegen
dpvlqrivdilyatdegfvipd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5jvmB (B:)
lsnedpkdtllrefqeeiarlkaqlekkgmlvedlekerdfyfgklrnielicqenegen
dpvlqrivdilyatdegfvipd

    Sequence, based on observed residues (ATOM records): (download) 
    >5jvmB (B:)
lsnedpkdtllrefqeeiarlkaqlekkgmlvedlekerdfyfgklrnielicqenegen
dpvlqrivdilyatdegfv