PDB entry 5jvf

View 5jvf on RCSB PDB site
Description: crystal structure of apo-flen
Deposited on 2016-05-11, released 2017-03-29
The last revision was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: site-determining protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: fleN
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jvfA (A:)
    gplgsmkqmgsmhpvqviavtggkggvgktnvsvnlalaladlgrrvmlldadlglanvd
    vllgltpkrtladviegrcelrdvlllgpggvrivpaasgtqsmvhlspmqhagliqafs
    disdnldvlvvdtaagigdsvvsfvraaqevllvvcdeptsitdayalikllnrdhgmtr
    frvlanmahspqegrnlfakltkvtdrfldvalqyvgvipydesvrkavqkqravyeafp
    rskaslafkavaqkvdswplpanprghleffverlvqhpatgsav
    

    Sequence, based on observed residues (ATOM records):
    >5jvfA (A:)
    mhpvqviavtggkgktnvsvnlalaladlgrrvmlldadlglanvdvllgltpkrtladv
    iegrcelrdvlllgpggvrivpaasgtqsmvhlspmqhagliqafsdisdnldvlvvdta
    agdsvvsfvraaqevllvvcdeptsitdayalikllnrdhgmtrfrvlanmahspqegrn
    lfakltkvtdrfldvalqyvgvipydesvrkavqkqravyeafprskaslafkavaqkvd
    swplpanprghleffverlvqh