PDB entry 5jv0

View 5jv0 on RCSB PDB site
Description: Crystal structure of human FPPS in complex with an allosteric inhibitor CL-08-038
Class: Transferase/Transferase Inhibitor
Keywords: Transferase, Transferase-Transferase Inhibitor complex
Deposited on 2016-05-10, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: farnesyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jv0f_
  • Heterogens: SO4, YL5, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jv0F (F:)
    mgsshhhhhhssgrenlyfqghmngdqnsdvyaqekqdfvqhfsqivrvltedemghpei
    gdaiarlkevleynaiggkynrgltvvvafrelveprkqdadslqrawtvgwcvellqaf
    flvaddimdssltrrgqicwyqkpgvgldaindanlleaciyrllklycreqpyylnlie
    lflqssyqteigqtldlltapqgnvdlvrftekryksivkyktafysfylpiaaamymag
    idgekehanakkillemgeffqiqddyldlfgdpsvtgkigtdiqdnkcswlvvqclqra
    tpeqyqilkenygqkeaekvarvkalyeeldlpavflqyeedsyshimalieqyaaplpp
    avflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jv0F (F:)
    dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
    frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
    aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapnvdlvrft
    ekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyldlf
    gdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyeeld
    lpavflqyeedsyshimalieqyaaplppavflglarkiyk