PDB entry 5jun

View 5jun on RCSB PDB site
Description: pb2 bound to an azaindole inhibitor
Deposited on 2016-05-10, released 2017-05-17
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase basic protein 2
    Species: Influenza A virus [TaxId:383596]
    Gene: pb2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q30NP1 (Start-168)
      • engineered mutation (74)
  • Heterogens: 6NU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5junA (A:)
    ghmrisssfsfggftfkrtsgssikreeevltgnlqtlkirvhegyeeftmvgkratail
    rkatrrlvqlivsgkdeqsiaeaiivamvfsqedcmikavrgdlnfvnranqrlnpmhql
    lrhfqkdakvlfqnwgiehidnvmgmvgvlpdmtpstemsmrgirvskm
    

    Sequence, based on observed residues (ATOM records):
    >5junA (A:)
    ssfsfggftfkrtsgssikreeevltgnlqtlkirvhegyeeftmvgkratailrkatrr
    lvqlivsgkdeqsiaeaiivamvfsqedcmikavrgdlnfvnrrlnpmhqllrhfqkdak
    vlfqnwgiehidnvmgmvgvlpdmtpstemsmrgirvskm