PDB entry 5jum

View 5jum on RCSB PDB site
Description: crystal structure of human dna polymerase eta inserting dctp opposite n-(2'-deoxyguanosin-8- yl)-3-aminobenzanthrone (c8-dg-aba)
Deposited on 2016-05-10, released 2016-09-07
The last revision was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-434)
      • expression tag (0-2)
  • Chain 'P':
    Compound: DNA (5'-d(*ap*gp*cp*gp*tp*cp*ap*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*c*ap*tp*(4e9)p*ap*tp*gp*ap*cp*gp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: DCP, CA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jumA (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >5jumA (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgptvqkegmrkqglfqwldslqidn
    ltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvshgs
    vpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlyamc
    rgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndndrv
    atqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsppltml
    flcatkfsas
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.